Property Summary

NCBI Gene PubMed Count 16
PubMed Score 174.55
PubTator Score 44.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Ovarian Cysts 41 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 6.3e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.490 6.3e-06

Gene RIF (8)

AA Sequence

MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESP      1 - 70
ALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTV     71 - 140
YTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEY    141 - 210
VLAAISLYLDIINLFLHLLRFLEAVNKK                                              211 - 238
//

Text Mined References (18)

PMID Year Title