Property Summary

NCBI Gene PubMed Count 16
Grant Count 25
R01 Count 8
Funding $2,427,495.48
PubMed Score 154.43
PubTator Score 44.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.490 0.000

Gene RIF (8)

PMID Text
25764978 These results suggest that the TMBIM family has comparable functions in the maintenance of intracellular Ca(2) homeostasis in a wide variety of tissues
23940116 The hGAAP is a novel regulator of focal adhesion dynamics, cell adhesion, and migration by controlling localized Ca(2+)-dependent activation of calpain.
23508950 GAAP can oligomerize in a pH-regulated manner, and monomeric GAAP is functional.
23000903 Taken together, the proposed interaction between Chlamydia pneumoniae protein CPn0809 and GAAP modulates bacterial growth in A549 cells.
22418439 Data indicate that GAAP and BI-1 have a six membrane-spanning topology with cytosolic N and C termini and a C-terminal reentrant loop.
19553469 Data demonstrate that h-GAAP modulates intracellular Ca(2+) fluxes induced by both physiological and apoptotic stimuli.
18440869 The tmbim4 may participate in cell death regulation by interacting with proteins of Bcl-2 family, promoting tumor metastasis, which is deduced from the evolutionary conservation of the membrane protein family containing multiple membrane spanning segments
17319741 Stable expression of both viral GAAP (v-GAAP) and human GAAP (h-GAAP), which is expressed in all human tissues tested, inhibited apoptosis induced by intrinsic and extrinsic apoptotic stimuli

AA Sequence

MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESP      1 - 70
ALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTV     71 - 140
YTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEY    141 - 210
VLAAISLYLDIINLFLHLLRFLEAVNKK                                              211 - 238
//

Text Mined References (18)

PMID Year Title
25764978 2015 The transmembrane Bax inhibitor motif (TMBIM) containing protein family: Tissue expression, intracellular localization and effects on the ER CA²?-filling state.
23940116 2013 hGAAP promotes cell adhesion and migration via the stimulation of store-operated Ca2+ entry and calpain 2.
23508950 2013 Human and viral Golgi anti-apoptotic proteins (GAAPs) oligomerize via different mechanisms and monomeric GAAP inhibits apoptosis and modulates calcium.
23000903 2013 Host cell Golgi anti-apoptotic protein (GAAP) and growth of Chlamydia pneumoniae.
22418439 2012 Six-transmembrane topology for Golgi anti-apoptotic protein (GAAP) and Bax inhibitor 1 (BI-1) provides model for the transmembrane Bax inhibitor-containing motif (TMBIM) family.
19784873 2009 LFG: a candidate apoptosis regulatory gene family.
19553469 2009 Human Golgi antiapoptotic protein modulates intracellular calcium fluxes.
18440869 2008 Comparative genomics and function analysis on BI1 family.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17319741 2007 A new inhibitor of apoptosis from vaccinia virus and eukaryotes.
More...