Property Summary

NCBI Gene PubMed Count 45
Grant Count 50
R01 Count 14
Funding $5,865,020.6
PubMed Score 168.78
PubTator Score 146.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (35)

PMID Text
26728949 Prokineticin-2 is correlated with various cardiometabolic risk factors.
26574895 Data suggest that prokineticins (PROK1 and PROK2) and prokineticin receptors (PROKR1 and PROKR2) act as main regulators of physiological functions of ovary, uterus, placenta, and testis. [REVIEW]
26317645 Suggest PROK2 as an angiogenic growth factor in colorectal cancer.
26192875 PROK2 significantly increased in human fetal ovary across gestation.
26047640 EG-VEGF, BV8, and PROKR2 gene expression is approximately five, four, and two times higher in cystic fibrosis lungs compared with controls.
25531638 study found a novel mutation in PROK2 in two male siblings presenting normosmic congenital hypogonadotropic hypogonadism, in whom a mutation in the GNRHR gene had been previously described, suggesting the possibility of a digenic inheritance
24423319 PROK2 signaling in humans is not required for central circadian pacemaker function.
24002956 No abnormalities were found in the patient group for the PROKR2 and GNRH1genes. In addition, no genomic rearrangements were identified in the healthy control individuals for the described genes
23548897 A novel role of BV8 in promoting oncogenesis intrinsic to malignant cells of myeloid origin.
23386640 We could not implicate the ligand PROK2 in congenital hypopituitarism and septo-optic dysplasia.
More...

AA Sequence

MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHP      1 - 70
LTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK                71 - 129
//

Text Mined References (46)

PMID Year Title
26728949 2016 Prokineticin-2 is associated with metabolic syndrome in a middle-aged and elderly Chinese population.
26574895 2015 Prokineticins in central and peripheral control of human reproduction.
26317645 2015 Prokineticin 2 (PROK2) is an important factor for angiogenesis in colorectal cancer.
26192875 2015 Prokineticin Ligands and Receptors Are Expressed in the Human Fetal Ovary and Regulate Germ Cell Expression of COX2.
26047640 2015 EG-VEGF, BV8, and their receptor expression in human bronchi and their modification in cystic fibrosis: Impact of CFTR mutation (delF508).
25531638 2015 Triallelic digenic mutation in the prokineticin 2 and GNRH receptor genes in two brothers with normosmic congenital hypogonadotropic hypogonadism.
25077900 2014 The prevalence of CHD7 missense versus truncating mutations is higher in patients with Kallmann syndrome than in typical CHARGE patients.
24423319 2014 Absence of central circadian pacemaker abnormalities in humans with loss of function mutation in prokineticin 2.
24002956 2013 [Multiplex ligation dependent probe amplification analysis of KAL1, GNRH1, GNRHR, PROK2 and PROKR2 in male patients with idiopathic hypogonadotropic hypogonadism].
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
More...