Property Summary

NCBI Gene PubMed Count 335
Grant Count 490
R01 Count 173
Funding $79,295,876.31
PubMed Score 642.19
PubTator Score 538.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.218 0.011
malignant mesothelioma 3.900 0.000
cutaneous lupus erythematosus 2.700 0.000
osteosarcoma -2.397 0.002
glioblastoma 1.400 0.007
astrocytoma -1.200 0.025
adrenocortical carcinoma -1.280 0.025
chronic kidney disease 1.200 0.038
tuberculosis and treatment for 6 months -1.300 0.000
lung cancer -2.400 0.000
active Crohn's disease 1.480 0.007
Breast cancer 1.800 0.045
adult high grade glioma 1.200 0.006
pilocytic astrocytoma 1.200 0.000
primary Sjogren syndrome 2.400 0.000
subependymal giant cell astrocytoma 2.007 0.045
invasive ductal carcinoma 1.023 0.009
psoriasis 1.100 0.000
lung carcinoma -1.700 0.000
ulcerative colitis 2.600 0.000
ovarian cancer -1.100 0.000
pituitary cancer 2.000 0.000

Synonym

Accession Q9HC16 B2RDR9 Q45F02 Q5TF77 Q7Z2N1 Q7Z2N4 Q9H9H8
Symbols A3G
ARCD
ARP9
ARP-9
CEM15
CEM-15
MDS019
bK150C2.7
dJ494G10.1

Gene

PANTHER Protein Class (2)

PDB

2JYW   2KBO   2KEM   3E1U   3IQS   3IR2   3V4J   3V4K   4ROV   4ROW  

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
493012 screening 933 / 0 / 330928 uHTS identification of APOBEC3G DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay
493028 summary 0 / 0 / 0 Summary assay for APOBEC3G DNA Deaminase Inhibitors
493152 screening 644 / 0 / 247 Single concentration confirmation of uHTS for APOBEC3G DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay
504719 confirmatory 449 / 0 / 10 Dose Response confirmation of small molecule APOBEC3G DNA Deaminase Inhibitors via a fluorescence-based single-stranded DNA deaminase assay
504723 confirmatory 438 / 0 / 10 Dose Response confirmation of APOBEC3A DNA Deaminase Inhibitors via a A3G counterscreen
588379 confirmatory 11 / 36 / 1344 qHTS for inhibitors of Vif-A3G interactions: Validation
588444 summary 0 / 0 / 0 qHTS for inhibitors of Vif-A3G interactions: Summary
602136 confirmatory 17 / 0 / 82 SAR analysis of small molecule inhibitors of APOBEC3G DNA Deaminase via a fluorescence-based single-stranded DNA deaminase assay
602310 confirmatory 311 / 8292 / 398161 qHTS for Inhibitors of Vif-A3G Interactions: qHTS
624087 confirmatory 20 / 0 / 23 SAR analysis of small molecule inhibitors of APOBEC3G DNA Deaminase via a fluorescence-based single-stranded DNA deaminase assay - Set 2
More...

Gene RIF (1279)

PMID Text
27003258 STAT3 plays an important role in IFN-induced A3G production, and HBsAg may correlated with poor response to IFN treatment
26772882 USF1 gene can take part in basal transcription regulation of the human A3G gene in hepatocyte, and the identified E-box represented a binding site for the USF1.
26741797 This study demonstrates an association of rs6001417, rs8177832, and rs35228531 of APOBEC3G with HIV-1 infection in a population from Burkina Faso.
26668372 Data show that restriction factor APOBEC3G (A3G) is susceptible to degradation by the HIV-1 Vif protein, whereas restriction factor APOBEC3B (A3B) is resistant to Vif.
26503602 Atomic Force spectroscopy revealed two distinct binding modes by which A3G interacts with ssDNA. One mode requires sequence specificity, as demonstrated by stronger and more stable complexes with deaminase specific ssDNA than with nonspecific ssDNA.
26482266 Findings support a role for APOBEC3G/F proteins in the generation of plasma drug-resistant minority human immunodeficiency virus type 1 variants (DRMVs). However, this role seems to be limited to a small subset of mutations and does not explain most of the DRMVs evaluated.
26460502 HIV-1 Vif interacts with APOBEC3G as demonstrated by co-immunoprecipitation assay
26424853 The data predicts a mechanistic model of RNA inhibition of ssDNA binding to APOBEC3G in which competitive and allosteric interactions determine RNA-bound versus ssDNA-bound conformational states.
26385832 HIV-1 Vif interacts with APOBEC3G as demonstrated by co-immunoprecipitation assay
26275799 Results were consistent with Pokeweed antiviral protein activity inhibiting translation of Vif, which in turn reduces the effect of Vif to inactivate the host restriction factor APOBEC3G.
More...

AA Sequence

MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYSELKYHPEMRF      1 - 70
FHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQ     71 - 140
KRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNFNNEP    141 - 210
WVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVT    211 - 280
CFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTF    281 - 350
VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN                                        351 - 384
//

Text Mined References (348)

PMID Year Title
27003258 2016 HBsAg blocks TYPE I IFN induced up-regulation of A3G through inhibition of STAT3.
26772882 2016 Basal transcription of APOBEC3G is regulated by USF1 gene in hepatocyte.
26741797 2016 APOBEC3G Variants and Protection against HIV-1 Infection in Burkina Faso.
26668372 2015 Specific induction of endogenous viral restriction factors using CRISPR/Cas-derived transcriptional activators.
26503602 2015 APOBEC3G Interacts with ssDNA by Two Modes: AFM Studies.
26482266 2016 Contribution of APOBEC3G/F activity to the development of low-abundance drug-resistant human immunodeficiency virus type 1 variants.
26424853 2015 RNA binding to APOBEC3G induces the disassembly of functional deaminase complexes by displacing single-stranded DNA substrates.
26275799 2015 Pokeweed antiviral protein restores levels of cellular APOBEC3G during HIV-1 infection by depurinating Vif mRNA.
26178819 2015 The virus-induced protein APOBEC3G inhibits anoikis by activation of Akt kinase in pancreatic cancer cells.
26105074 2015 The HDAC6/APOBEC3G complex regulates HIV-1 infectiveness by inducing Vif autophagic degradation.
More...