Property Summary

NCBI Gene PubMed Count 15
PubMed Score 39.21
PubTator Score 14.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.465 2.6e-03
active ulcerative colitis 1.028 4.6e-03
adrenocortical carcinoma -1.197 4.3e-03
adult high grade glioma -1.400 1.2e-03
aldosterone-producing adenoma -1.091 2.2e-02
Breast cancer 1.100 8.1e-07
ependymoma 1.100 8.7e-03
glioblastoma -1.100 7.0e-04
group 4 medulloblastoma -1.100 6.3e-03
intraductal papillary-mucinous adenoma (... 1.500 5.6e-03
intraductal papillary-mucinous carcinoma... 1.200 4.9e-02
intraductal papillary-mucinous neoplasm ... 1.800 3.2e-02
medulloblastoma, large-cell -1.300 1.3e-04
oligodendroglioma 1.100 2.6e-03
osteosarcoma 2.123 1.4e-05
ovarian cancer 1.500 1.4e-02
pancreatic cancer 1.100 4.1e-04
pancreatic carcinoma 1.100 4.1e-04
Pick disease -1.200 9.9e-04
primary pancreatic ductal adenocarcinoma 2.071 1.3e-02
primary Sjogren syndrome 1.100 3.7e-02
progressive supranuclear palsy -1.400 1.2e-02
psoriasis 1.300 7.1e-11
tuberculosis and treatment for 6 months -1.200 1.2e-02

Gene RIF (8)

AA Sequence

MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAVQGPEPARVEK      1 - 70
IFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIMAMRYNRLTVLAGAMLALGLM     71 - 140
TCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLL    141 - 210
NGPGDVETGTSITVPQKKWLHFISPIFVQALTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLC    211 - 280
TGLAVIGGRMIAQKISVRTVTIIGGIVFLAFAFSALFISPDSGF                              281 - 324
//

Text Mined References (18)

PMID Year Title