Property Summary

NCBI Gene PubMed Count 26
Grant Count 18
R01 Count 13
Funding $1,417,823.27
PubMed Score 53.03
PubTator Score 24.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
medulloblastoma -1.500 0.000
cystic fibrosis -1.478 0.000
atypical teratoid / rhabdoid tumor -1.400 0.002
glioblastoma -1.500 0.001
medulloblastoma, large-cell -2.700 0.000
lung cancer 1.100 0.012
breast carcinoma 1.600 0.001
pediatric high grade glioma -1.200 0.001
nasopharyngeal carcinoma 1.100 0.010
lung carcinoma 1.300 0.000
Breast cancer 1.100 0.005
ductal carcinoma in situ 1.300 0.018
ovarian cancer -2.600 0.000

Gene RIF (14)

PMID Text
25613063 Attenuated ARNT2 expression in HCC827 cells greatly promoted tumor growth.
24814368 Data suggest that selected human SIM1 (single-minded homolog 1) variants exhibit poor dimerization with ARNT2 and anomalous intracellular localization; these data were used to predict 'hot-spot' in SIM1/SIM2 (residues 290-326) critical for function.
24635660 nominal associations were found between autism spectrum disorder scores and single-nucleotide polymorphisms in OXT, ARNT2 and CD38
24465693 These results provide insight into the mechanisms of NPAS4/ARNT dimerisation and transcriptional activation.
24022475 mutation of ARNT2 results in absence of detectable levels of ARNT2 transcript and protein from patient fibroblasts compared with controls, consistent with nonsense-mediated decay of the mutant transcript and loss of ARNT2 function.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of aryl-hydrocarbon receptor nuclear translocator 2 (ARNT2) in peptide-treated PBMCs
21945317 ARNT2 might play an important role in the modulation of HIF-1-regulated signaling and metabolism.
21512513 In white males, rs4072568 in ARNT2 was also associated with BMI (P = 9 x 10(-4)) and % body fat (P = 0.001).
20706985 promotes differentiation of IL-22-producing CD4(+) T-cells
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSE      1 - 70
IERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPSFLTEQELKH     71 - 140
LILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGRI    141 - 210
LDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVV    211 - 280
HCTGYIKAWPPAGMTIPEEDADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFV    281 - 350
DPRCISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF    351 - 420
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQE    421 - 490
RDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNM    491 - 560
SQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYS    561 - 630
SLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGN    631 - 700
YNIEDFADLGMFPPFSE                                                         701 - 717
//

Text Mined References (29)

PMID Year Title
25613063 2015 ARNT2 is downregulated and serves as a potential tumor suppressor gene in non-small cell lung cancer.
24814368 2014 Characterization of human variants in obesity-related SIM1 protein identifies a hot-spot for dimerization with the partner protein ARNT2.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24635660 2014 Associations between oxytocin-related genes and autistic-like traits.
24465693 2014 Human variants in the neuronal basic helix-loop-helix/Per-Arnt-Sim (bHLH/PAS) transcription factor complex NPAS4/ARNT2 disrupt function.
24022475 2013 ARNT2 mutation causes hypopituitarism, post-natal microcephaly, visual and renal anomalies.
21945317 2011 siRNA-mediated knockdown of aryl hydrocarbon receptor nuclear translocator 2 affects hypoxia-inducible factor-1 regulatory signaling and metabolism in human breast cancer cells.
21512513 2011 Replication and extension of association between common genetic variants in SIM1 and human adiposity.
20706985 2010 Activation of the aryl hydrocarbon receptor reveals distinct requirements for IL-22 and IL-17 production by human T helper cells.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
More...