Property Summary

NCBI Gene PubMed Count 26
PubMed Score 54.13
PubTator Score 24.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
WEBB-DATTANI SYNDROME 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 0.9
Disease of anatomical entity 32 0.0 0.8
Disease Target Count Z-score Confidence
Adenoid hypertrophy 6 3.281 1.6
Asperger syndrome 37 3.103 1.6
Hypospadias 53 3.007 1.5

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 2.0e-03
Breast cancer 1.100 4.8e-03
breast carcinoma 1.600 5.2e-04
cystic fibrosis -1.478 3.4e-06
ductal carcinoma in situ 1.300 1.8e-02
glioblastoma -1.500 9.2e-04
lung cancer 1.100 1.2e-02
lung carcinoma 1.300 2.6e-18
malignant mesothelioma -2.700 3.2e-07
medulloblastoma -1.100 7.3e-06
medulloblastoma, large-cell -2.700 3.3e-04
nasopharyngeal carcinoma 1.100 9.6e-03
ovarian cancer -2.600 3.1e-08
pediatric high grade glioma -1.200 6.5e-04

Protein-protein Interaction (7)

Gene RIF (14)

AA Sequence

MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSE      1 - 70
IERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPSFLTEQELKH     71 - 140
LILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGRI    141 - 210
LDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVV    211 - 280
HCTGYIKAWPPAGMTIPEEDADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFV    281 - 350
DPRCISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF    351 - 420
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADAIFSQE    421 - 490
RDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVNDIQSSSSTGQNM    491 - 560
SQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYS    561 - 630
SLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGN    631 - 700
YNIEDFADLGMFPPFSE                                                         701 - 717
//

Text Mined References (29)

PMID Year Title