Property Summary

NCBI Gene PubMed Count 21
PubMed Score 4.28
PubTator Score 7.79

Knowledge Summary

Patent (4,248)

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
active ulcerative colitis -1.097 4.9e-02
cutaneous lupus erythematosus 2.500 3.4e-02
ductal carcinoma in situ -1.600 8.3e-03
invasive ductal carcinoma -1.200 8.1e-03
osteosarcoma -1.518 2.5e-06
pancreatic ductal adenocarcinoma liver m... -2.749 2.6e-04
psoriasis -1.800 2.1e-23

Gene RIF (8)

AA Sequence

MQGLLTSGRKPSGGGRCTGRGGWRGQWCLKPWMGGADPPTPTLSCLLLPVPPELPDHCYRMNSSPAGTPS      1 - 70
PQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHI     71 - 140
MAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYL    141 - 210
HSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCL    211 - 280
GAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHV    281 - 350
FFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE    351 - 420
DDDILDC                                                                   421 - 427
//

Text Mined References (25)

PMID Year Title