Property Summary

NCBI Gene PubMed Count 19
Grant Count 15
R01 Count 10
Funding $1,495,066.8
PubMed Score 4.09
PubTator Score 7.79

Knowledge Summary

Patent (4,248)

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.500 0.034
osteosarcoma -1.518 0.000
pancreatic ductal adenocarcinoma liver m... -2.749 0.000
ulcerative colitis -3.500 0.000
ductal carcinoma in situ -1.600 0.008
invasive ductal carcinoma -1.600 0.041
psoriasis -1.800 0.000

Gene RIF (6)

PMID Text
26740304 SGK2 stimulated hOAT4 transport activity by abrogating the inhibitory effect of Nedd4-2 on the transporter.
24204015 Activation of hepatocyte pregnane X receptor is mediated through serum- and glucocorticoid-regulated kinase (SGK)2.
20511718 Glucocorticoid inducible kinase isoforms SGK1-3 are novel potent stimulators of Slc6a19 and may thus participate in the regulation of neutral amino acid transport in vivo.
15578212 Co-expression of SGK1, but not of SGK2 or SGK3, increased Kv 4.3/KChIP2b channel currents.
12634932 All three members of the SGK family of kinases SGK1-3 and protein kinase B stimulate the slowly activating K(+) channel KCNE1/KCNQ1. The kinases may thus participate in the regulation of KCNE1-dependent transport and excitability.
12397388 Powerful stimulating effect of all three isoforms of SGK on K(+) channels. Those effects may participate in regulation of epithelial transport, cell proliferation, and neuromuscular excitability.

AA Sequence

MQGLLTSGRKPSGGGRCTGRGGWRGQWCLKPWMGGADPPTPTLSCLLLPVPPELPDHCYRMNSSPAGTPS      1 - 70
PQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHI     71 - 140
MAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYL    141 - 210
HSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCL    211 - 280
GAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHV    281 - 350
FFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE    351 - 420
DDDILDC                                                                   421 - 427
//

Text Mined References (23)

PMID Year Title
26740304 2016 Serum- and glucocorticoid-inducible kinase SGK2 regulates human organic anion transporters 4 via ubiquitin ligase Nedd4-2.
26392083 2015 Statin-activated nuclear receptor PXR promotes SGK2 dephosphorylation by scaffolding PP2C to induce hepatic gluconeogenesis.
24204015 2014 Serum- and glucocorticoid-regulated kinase 2 determines drug-activated pregnane X receptor to induce gluconeogenesis in human liver cells.
21865597 2011 Serum- and glucocorticoid-induced kinase 3 in recycling endosomes mediates acute activation of Na+/H+ exchanger NHE3 by glucocorticoids.
20919962 2010 Second AKT: the rise of SGK in cancer signalling.
20511718 2010 The serum and glucocorticoid inducible kinases SGK1-3 stimulate the neutral amino acid transporter SLC6A19.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16460280 2006 Sgk kinases and their role in epithelial transport.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
More...