Property Summary

Ligand Count 1
NCBI Gene PubMed Count 67
PubMed Score 176.73
PubTator Score 114.41

Knowledge Summary

Patent (7,580)

Expression

  Differential Expression (18)

Disease log2 FC p
Endometriosis -1.234 2.0e-02
adrenocortical adenoma -1.341 1.9e-04
adrenocortical carcinoma -1.397 1.0e-10
adult high grade glioma -1.700 3.4e-02
Alzheimer's disease -1.700 3.7e-02
astrocytic glioma -1.600 8.5e-03
Astrocytoma, Pilocytic -2.100 4.4e-04
atypical teratoid / rhabdoid tumor -2.200 1.1e-05
ependymoma -1.900 6.5e-03
glioblastoma -1.900 2.4e-05
group 3 medulloblastoma -2.400 3.6e-02
lung adenocarcinoma -1.900 8.6e-14
lung carcinoma -2.600 1.3e-13
medulloblastoma, large-cell -2.300 6.1e-03
non-small cell lung cancer -1.248 1.1e-14
oligodendroglioma -1.500 4.1e-02
Pick disease -2.000 1.8e-03
primitive neuroectodermal tumor -2.600 1.9e-04

Gene RIF (56)

AA Sequence

MTSGSVFFYILIFGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADEDNCGDNNGWSL      1 - 70
QFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRAVPSVSSNVTAMSLQWNLIRK     71 - 140
LPPDCFKNYHDLQKLYLQNNKITSISIYAFRGLNSLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHL    141 - 210
SRISPPTFYGLNSLILLVLMNNVLTRLPDKPLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNLTVLVMRK    211 - 280
NKINHLNENTFAPLQKLDELDLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSL    281 - 350
EGIEISNIQQRMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAVTC    351 - 420
FGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKFRGEYNKHAQLWMESTHCQLVGS    421 - 490
LAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWITGFIVAFIPLSNKEFFKNYYGTN    491 - 560
GVCFPLHSEDTESIGAQIYSVAIFLGINLAAFIIIVFSYGSMFYSVHQSAITATEIRNQVKKEMILAKRF    561 - 630
FFIVFTDALCWIPIFVVKFLSLLQVEIPGTITSWVVIFILPINSALNPILYTLTTRPFKEMIHRFWYNYR    631 - 700
QRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS                 701 - 757
//

Text Mined References (69)

PMID Year Title