Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9HBX3 B3KNA6 O95358
Symbols NAG8
NSG-X
C7orf54

Gene

 Compartment GO Term (0)

AA Sequence

MSHHPHSLRNSCLIRMDLLYWQFTIYTITFCFSHLSGRLTLSAQHISHRPCLLSYSLLFWKVHHLFLEGF      1 - 70
PCSPRLDEMSFHQFPQHPVHVSVVHLPIVYKGSMTQVSPH                                   71 - 110
//

Text Mined References (4)

PMID Year Title