Property Summary

NCBI Gene PubMed Count 53
Grant Count 59
R01 Count 50
Funding $4,609,060.88
PubMed Score 85.00
PubTator Score 86.06

Knowledge Summary

Patent (14,243)

Expression

Synonym

Accession Q9HBW0 O00543 O43431 LPA receptor 2
Symbols EDG4
LPA2
EDG-4
LPA-2

Gene

PANTHER Protein Class (2)

PDB

4P0C  

  TechDev Info (1)

Gene RIF (30)

PMID Text
26327335 Data show high expression levels of LPAR2 and LPAR1 in endometrial cancer tissue with positive correlations with FIGO stage suggesting them as potential biomarkers for endometrial cancer progression.
25463482 Suggest that LPA2 and LPA3 may function as a molecular switch and play opposing roles during megakaryopoiesis of K562 cells.
24950964 the RhoA-regulated formin Dia1 is involved in entosis downstream of LPAR2
24613836 Crystal structure of NHERF2 PDZ1 domain complex with C-terminal LPA2 sequence. The PDZ1-LPA2 binding specificity is achieved by hydrogen bonds and hydrophobic contacts with the last four LPA2 residues contributing to specific interactions.
24061591 LPA1 and LPA2 are major LPA receptor subtypes compared with low-expressed LPA3 in PANC-1 tumor cells.
23569130 Lysophosphatidic acid (LPA) increased hepatocellular carcinoma cells cell invasion, which was LPA-receptor dependent.
23084965 LPA2 and LPA6 receptor subtypes are predominant in both HPAECs and HMVECs
21964883 found that LPA receptor 2/3-mediated IL-8 expression occurs through Gi/PI3K/AKT, Gi/PKC and IkappaB/NF-kappaB signaling
21234797 This work shows for the first time that key components of the LPA pathway are modulated following traumatic brain injuries in humans.
21134377 MAGI-3 competes with NHERF-2 to negatively regulate LPA2 receptor signaling in colon cancer cells.
More...

AA Sequence

MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIYYL      1 - 70
LGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVATLLAIAVERHRSVMAVQLHS     71 - 140
RLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSRMAPLLSRSYLAVWALSSLLVFLLMVAVYTR    141 - 210
IFFYVRRRVQRMAEHVSCHPRYRETTLSLVKTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYF    211 - 280
LLLAEANSLVNAAVYSCRDAEMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDST    281 - 350
L//

Text Mined References (53)

PMID Year Title
26327335 2015 The significance of the altered expression of lysophosphatidic acid receptors, autotaxin and phospholipase A2 as the potential biomarkers in type 1 endometrial cancer biology.
25463482 2015 Opposing regulation of megakaryopoiesis by LPA receptors 2 and 3 in K562 human erythroleukemia cells.
24950964 2014 G-protein-coupled receptor signaling and polarized actin dynamics drive cell-in-cell invasion.
24613836 2014 Structural insights into PDZ-mediated interaction of NHERF2 and LPA(2), a cellular event implicated in CFTR channel regulation.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
24061591 2013 Lysophosphatidic acid stimulates activation of focal adhesion kinase and paxillin and promotes cell motility, via LPA1-3, in human pancreatic cancer.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23569130 2013 Enhancement of invasion of hepatocellular carcinoma cells through lysophosphatidic acid receptor.
23084965 2013 Comparing the differential effects of LPA on the barrier function of human pulmonary endothelial cells.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
More...