Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.71
PubTator Score 5.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Heart disease 306 0.0 1.4
Disease Target Count Z-score Confidence
Infertility 188 4.068 2.0

Gene RIF (4)

AA Sequence

MSPRGTGCSAGLLMTVGWLLLAGLQSARGTNVTAAVQDAGLAHEGEGEEETENNDSETAENYAPPETEDV      1 - 70
SNRNVVKEVEFGMCTVTCGIGVREVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIH     71 - 140
TSPLNRFKYMWKLLRQDQQSIILVNDSAILEVRKESHPLAFECDTLDNNEIVATIKFTVYTSSELQMRRS    141 - 210
SLPATDAALIFVLTIGVIICVFIIFLLIFIIINWAAVKAFWGAKASTPEVQSEQSSVRYKDSTSLDQLPT    211 - 280
EMPGEDDALSEWNE                                                            281 - 294
//

Text Mined References (10)

PMID Year Title