Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.46
PubTator Score 5.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Infertility 163 4.083 2.0
Heart disease 279 1.0

Synonym

Accession Q9HBV2
Symbols SAMP32

Gene

 GO Process (1)

Gene RIF (2)

PMID Text
20424473 Observational study of gene-disease association. (HuGE Navigator)
11870081 SAMP32 was associated with the inner acrosomal membrane and recombinant SAMP32 reacted with serum from an infertile man suggesting that it is isoantigenic

AA Sequence

MSPRGTGCSAGLLMTVGWLLLAGLQSARGTNVTAAVQDAGLAHEGEGEEETENNDSETAENYAPPETEDV      1 - 70
SNRNVVKEVEFGMCTVTCGIGVREVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIH     71 - 140
TSPLNRFKYMWKLLRQDQQSIILVNDSAILEVRKESHPLAFECDTLDNNEIVATIKFTVYTSSELQMRRS    141 - 210
SLPATDAALIFVLTIGVIICVFIIFLLIFIIINWAAVKAFWGAKASTPEVQSEQSSVRYKDSTSLDQLPT    211 - 280
EMPGEDDALSEWNE                                                            281 - 294
//

Text Mined References (8)

PMID Year Title
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
17903301 2007 Genome-wide association of echocardiographic dimensions, brachial artery endothelial function and treadmill exercise responses in the Framingham Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11870081 2002 SAMP32, a testis-specific, isoantigenic sperm acrosomal membrane-associated protein.
10898932 2000 Mammalian sperm acrosome: formation, contents, and function.
10735589 2000 Anti-sperm antibodies from infertile patients and their cognate sperm antigens: a review. Identity between SAGA-1, the H6-3C4 antigen, and CD52.