Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
Funding $83,875
PubMed Score 3.69
PubTator Score 10.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
astrocytic glioma -2.900 0.002
ependymoma -3.000 0.004
oligodendroglioma -2.500 0.011
glioblastoma multiforme -1.300 0.000
osteosarcoma 2.070 0.016
medulloblastoma -1.300 0.009
cystic fibrosis 1.108 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
acute quadriplegic myopathy -1.001 0.000
active ulcerative colitis -3.135 0.012

Gene RIF (5)

PMID Text
22654436 Reduced expression of Popdc3 may play a significant role in the carcinogenesis and progression of gastric cancer. Popdc3 may be an independent prognostic factor.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627872 Frequent silencing of POPDC3 is associated with promoter hypermethylation in gastric cancer.
20546612 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWV      1 - 70
DVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEK     71 - 140
EHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYV    141 - 210
SWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQ    211 - 280
HFQNSRRYCDK                                                               281 - 291
//

Text Mined References (15)

PMID Year Title
22654436 2012 Reduced Popdc3 expression correlates with high risk and poor survival in patients with gastric cancer.
21654844 2011 Genome-wide association study of severity in multiple sclerosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627872 2010 Frequent silencing of popeye domain-containing genes, BVES and POPDC3, is associated with promoter hypermethylation in gastric cancer.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19448622 2009 Genome-wide association study identifies sequence variants on 6q21 associated with age at menarche.
18391951 2008 Many sequence variants affecting diversity of adult human height.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...