Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.99
PubTator Score 10.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis -3.135 1.2e-02
acute quadriplegic myopathy -1.001 2.2e-05
astrocytic glioma -2.900 2.1e-03
atypical teratoid / rhabdoid tumor -1.400 4.3e-05
cystic fibrosis 1.108 1.5e-04
ependymoma -3.000 4.0e-03
glioblastoma multiforme -1.300 2.1e-12
malignant mesothelioma -3.200 3.1e-08
medulloblastoma -1.100 6.5e-03
oligodendroglioma -2.500 1.1e-02
osteosarcoma 2.070 1.6e-02

Gene RIF (5)

AA Sequence

MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWV      1 - 70
DVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEK     71 - 140
EHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYV    141 - 210
SWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQ    211 - 280
HFQNSRRYCDK                                                               281 - 291
//

Text Mined References (15)

PMID Year Title