Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.77
PubTator Score 1.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -1.500 0.000
non-inflammatory breast cancer -1.400 0.000
psoriasis -1.400 0.000

AA Sequence

MSANSSRVGQLLLQGSACIRWKQDVEGAVYHLANCLLLLGFMGGSGVYGCFYLFGFLSAGYLCCVLWGWF      1 - 70
SACGLDIVLWSFLLAVVCLLQLAHLVYRLREDTLPEEFDLLYKTLCLPLQVPLQTYKEIVHCCEEQVLTL     71 - 140
ATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPYQFMDSPEWESLQPSEEGVFQVTLTAETSCS    141 - 210
YISWPRKSLHLLLTKERYISCLFSALLGYDISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADAGP    211 - 280
ESEKGDEEVCEPAVSPPQATPTSLQQTPPCSTPPATTNFPAPPTRARLSRPDSGILASRIPLQSYSQVIS    281 - 350
RGQAPLAPTHTPEL                                                            351 - 364
//

Text Mined References (6)

PMID Year Title
26642364 2016 POPDC1(S201F) causes muscular dystrophy and arrhythmia by affecting protein trafficking.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10882522 2000 Isolation and characterization of the novel popeye gene family expressed in skeletal muscle and heart.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.