Property Summary

NCBI Gene PubMed Count 11
PubMed Score 38.84
PubTator Score 5.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Atypical chronic myeloid leukemia 4 4.949 2.5

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease -1.297 4.4e-02
active ulcerative colitis -1.217 4.4e-02
aldosterone-producing adenoma -1.317 3.7e-02
astrocytic glioma -1.100 3.6e-02
atypical teratoid / rhabdoid tumor -1.100 7.2e-03
Barrett's esophagus 1.900 2.1e-02
Breast cancer 3.600 2.7e-02
breast carcinoma 1.400 3.2e-22
cutaneous lupus erythematosus 1.300 1.7e-04
ductal carcinoma in situ 1.900 8.0e-05
gastric cancer 1.200 1.7e-03
hepatocellular carcinoma 1.100 1.4e-04
intraductal papillary-mucinous adenoma (... 2.100 4.4e-03
intraductal papillary-mucinous carcinoma... 1.500 4.1e-02
intraductal papillary-mucinous neoplasm ... 2.000 3.1e-02
invasive ductal carcinoma 2.300 1.7e-04
juvenile dermatomyositis 1.556 1.4e-10
lung adenocarcinoma 1.213 2.8e-03
lung cancer 1.100 5.4e-03
malignant mesothelioma -1.400 7.2e-07
nasopharyngeal carcinoma 1.100 1.9e-03
non primary Sjogren syndrome sicca -1.500 1.8e-02
non-small cell lung cancer 1.139 3.5e-13
osteosarcoma -1.507 1.3e-04
ovarian cancer 1.500 1.1e-02
pancreatic cancer 1.200 2.7e-02
pancreatic carcinoma 1.200 2.7e-02
Pick disease -1.200 6.0e-03
primary pancreatic ductal adenocarcinoma 1.029 4.1e-02
psoriasis 1.200 1.1e-03
Rheumatoid arthritis 1.300 1.7e-03
sarcoidosis 1.100 1.8e-02
tuberculosis -1.200 1.6e-02

Gene RIF (6)

AA Sequence

MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPA      1 - 70
VLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTL     71 - 140
QLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEF    141 - 210
IQGEALDPKHVCNPAIFRLIARQLAKIHAIHAHNGWIPKSNLWLKMGKYFSLIPTGFADEDINKRFLSDI    211 - 280
PSSQILQEEMTWMKEILSNLGSPVVLCHNDLLCKNIIYNEKQGDVQFIDYEYSGYNYLAYDIGNHFNEFA    281 - 350
GVSDVDYSLYPDRELQSQWLRAYLEAYKEFKGFGTEVTEKEVEILFIQVNQFALASHFFWGLWALIQAKY    351 - 420
STIEFDFLGYAIVRFNQYFKMKPEVTALKVPE                                          421 - 452
//

Text Mined References (13)

PMID Year Title