Property Summary

NCBI Gene PubMed Count 8
Grant Count 6
Funding $698,123.93
PubMed Score 30.31
PubTator Score 8.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.100 0.013
facioscapulohumeral dystrophy 3.500 0.000

Gene RIF (5)

PMID Text
26383589 we provide supportive evidence that genetic variants at FOXP1, BARX1, and FOXF1 confer risk for the development of EAC.
20634891 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18708738 Regional expression of barx1 was observed in epithelium before mixed dentition, while during mixed dentition gene appeared in hyaline cartilage. Expression of barx1 appears in cleft lip palate affected structures mainly in mixed dentition.
17486624 PITX2, BARX1, and FOXC1 mutations were absent in De Hauwere syndrome and suggest that De Hauwere syndrome is caused by a different gene.

AA Sequence

MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPF      1 - 70
HSHLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAAGAPHLPLELQLRGKLEAAGPGEPGTKAK     71 - 140
KGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESP    141 - 210
TKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED                              211 - 254
//

Text Mined References (11)

PMID Year Title
26383589 2015 Supportive evidence for FOXP1, BARX1, and FOXF1 as genetic risk loci for the development of esophageal adenocarcinoma.
24121790 2013 A genome-wide association study identifies new susceptibility loci for esophageal adenocarcinoma and Barrett's esophagus.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18708738 2008 Barx1, growth factors and apoptosis in facial tissue of children with clefts.
17486624 2007 Absence of PITX2, BARX1, and FOXC1 mutations in De Hauwere syndrome (Axenfeld-Rieger anomaly, hydrocephaly, hearing loss): a 25-year follow up.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10995576 2000 Cloning, characterization, localization, and mutational screening of the human BARX1 gene.
More...