Property Summary

NCBI Gene PubMed Count 8
PubMed Score 31.88
PubTator Score 8.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 3.500 6.0e-08
psoriasis -1.100 1.3e-02

Gene RIF (5)

AA Sequence

MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPF      1 - 70
HSHLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAAGAPHLPLELQLRGKLEAAGPGEPGTKAK     71 - 140
KGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESP    141 - 210
TKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED                              211 - 254
//

Text Mined References (11)

PMID Year Title