Property Summary

NCBI Gene PubMed Count 9
PubMed Score 23.31
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.18639012175334E-19
ovarian cancer 8492 1.00017634314696E-6
osteosarcoma 7933 1.29922573529289E-4
ependymoma 2514 0.00185486104940009
Pick disease 1893 0.00825312760290718
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0109653759699591
group 4 medulloblastoma 1875 0.0243687631092267

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 3.227 0.000
ependymoma 1.200 0.002
group 4 medulloblastoma 1.300 0.024
intraductal papillary-mucinous neoplasm ... -1.100 0.011
lung carcinoma 1.200 0.000
Pick disease -1.100 0.008
ovarian cancer -1.800 0.000

Synonym

Accession Q9HBM6 B2RUZ9 Q9Y2S3
Symbols DN7
DN-7
TAF9L
TAFII31L
TFIID-31

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

 MGI Term (1)

Gene RIF (2)

PMID Text
15899866 TAF9b (TAF9L) was identified as a subunit of TFIID.
12837753 RNA interference experiments suggest that TAF9L is essential for HeLa cell growth and this protein is involved in transcriptional repression.

AA Sequence

MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADD      1 - 70
VRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQG     71 - 140
RLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLIN    141 - 210
PSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM                                 211 - 251
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15899866 2005 TAF9b (formerly TAF9L) is a bona fide TAF that has unique and overlapping roles with TAF9.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...