Property Summary

NCBI Gene PubMed Count 9
PubMed Score 23.53
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.200 1.9e-03
group 4 medulloblastoma 1.300 2.4e-02
intraductal papillary-mucinous neoplasm ... -1.100 1.1e-02
lung carcinoma 1.200 4.2e-19
osteosarcoma 3.227 1.3e-04
ovarian cancer -1.800 1.0e-06
Pick disease -1.100 8.3e-03

Synonym

Accession Q9HBM6 B2RUZ9 Q9Y2S3
Symbols DN7
DN-7
TAF9L
TAFII31L
TFIID-31

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (2)

AA Sequence

MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADD      1 - 70
VRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQG     71 - 140
RLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLIN    141 - 210
PSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM                                 211 - 251
//

Text Mined References (14)

PMID Year Title