Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.33
PubTator Score 18.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 1.143 1.4e-02
adult high grade glioma 1.900 1.2e-04
Astrocytoma, Pilocytic 1.200 6.2e-06
Atopic dermatitis 1.800 1.9e-04
atypical teratoid / rhabdoid tumor 2.500 5.2e-06
Breast cancer 1.800 5.2e-10
breast carcinoma 1.400 4.3e-05
colon cancer 3.000 7.8e-03
ductal carcinoma in situ 1.200 2.6e-02
Endometriosis 1.324 2.2e-02
glioblastoma 2.500 1.3e-08
group 3 medulloblastoma 3.400 9.8e-09
intraductal papillary-mucinous carcinoma... 1.600 1.8e-03
intraductal papillary-mucinous neoplasm ... 2.500 3.4e-04
invasive ductal carcinoma 1.400 5.8e-03
lung adenocarcinoma 1.400 6.8e-06
lung cancer 1.800 2.5e-03
lung carcinoma 1.100 4.1e-08
malignant mesothelioma 2.000 2.0e-07
medulloblastoma, large-cell 3.500 1.5e-08
non-small cell lung cancer 2.113 2.2e-20
ovarian cancer 1.400 1.1e-03
posterior fossa group A ependymoma 1.200 9.9e-04
primitive neuroectodermal tumor 3.400 7.2e-07
psoriasis 1.700 3.2e-12
ulcerative colitis 1.100 4.2e-03

Gene RIF (3)

AA Sequence

MVEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEMFLEYQNQISR      1 - 70
QNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTANKANAERLKRLQKSADLYKD     71 - 140
RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAF    141 - 210
LANVRKAFTATVYN                                                            211 - 224
//

Text Mined References (17)

PMID Year Title