Property Summary

NCBI Gene PubMed Count 11
Grant Count 7
Funding $173,514.6
PubMed Score 0.33
PubTator Score 18.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
15961401 the Spc24, Spc25, Nuf2, and Ndc80/Hec1 complex is a faithful copy of the endogenous Ndc80 complex
14699129 hSPC25 is an essential kinetochore component that plays a significant role in proper execution of mitotic events

AA Sequence

MVEDELALFDKSINEFWNKFKSTDTSCQMAGLRDTYKDSIKAFAEKLSVKLKEEERMVEMFLEYQNQISR      1 - 70
QNKLIQEKKDNLLKLIAEVKGKKQELEVLTANIQDLKEEYSRKKETISTANKANAERLKRLQKSADLYKD     71 - 140
RLGLEIRKIYGEKLQFIFTNIDPKNPESPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAF    141 - 210
LANVRKAFTATVYN                                                            211 - 224
//

Text Mined References (16)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085020 2012 The kinetochore-bound Ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
21269460 2011 Initial characterization of the human central proteome.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15961401 2005 Architecture of the human ndc80-hec1 complex, a critical constituent of the outer kinetochore.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...