Property Summary

NCBI Gene PubMed Count 13
Grant Count 6
R01 Count 6
Funding $272,280.12
PubMed Score 13.42
PubTator Score 8.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.000 0.005
oligodendroglioma -1.600 0.038
psoriasis -2.200 0.000
glioblastoma -1.600 0.000
osteosarcoma 1.127 0.011
atypical teratoid / rhabdoid tumor -1.300 0.010
medulloblastoma, large-cell -1.600 0.000
tuberculosis -1.400 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.021
pediatric high grade glioma -1.100 0.012
nasopharyngeal carcinoma 1.400 0.005
ovarian cancer 1.800 0.003

Gene RIF (5)

PMID Text
25792470 VEZT expression levels can be considered as a biomarker for gastric cancer progression, lymphatic metastasis and as a novel independent prognostic factor.
25678572 vezatin and nearby SNP rs10859871 may have a role in endometriosis [meta-analysis]
24069310 VEZT, a novel putative tumor suppressor, suppresses the growth and tumorigenicity of gastric cancer.
21156161 miR-43c directly targets adherens junctions' transmembrane protein (VEZT) and suppresses VEZT protein expression.
16199027 function of mouse vezatin in mouse blastocyst morphogenesis

AA Sequence

MTPEFDEEVVFENSPLYQYLQDLGHTDFEICSSLSPKTEKCTTEGQQKPPTRVLPKQGILLKVAETIKSW      1 - 70
IFFSQCNKKDDLLHKLDIGFRLDSLHTILQQEVLLQEDVELIELLDPSILSAGQSQQQENGHLPTLCSLA     71 - 140
TPNIWDLSMLFAFISLLVMLPTWWIVSSWLVWGVILFVYLVIRALRLWRTAKLQVTLKKYSVHLEDMATN    141 - 210
SRAFTNLVRKALRLIQETEVISRGFTLVSAACPFNKAGQHPSQHLIGLRKAVYRTLRANFQAARLATLYM    211 - 280
LKNYPLNSESDNVTNYICVVPFKELGLGLSEEQISEEEAHNFTDGFSLPALKVLFQLWVAQSSEFFRRLA    281 - 350
LLLSTANSPPGPLLTPALLPHRILSDVTQGLPHAHSACLEELKRSYEFYRYFETQHQSVPQCLSKTQQKS    351 - 420
RELNNVHTAVRSLQLHLKALLNEVIILEDELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWE    421 - 490
EAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDD    491 - 560
FYYLSQEDKERQKREHEESKRVLQELKSVLGFKASEAERQKWKQLLFSDHAVLKSLSPVDPVEPISNSEP    561 - 630
SMNSDMGKVSKNDTEEESNKSATTDNEISRTEYLCENSLEGKNKDNSSNEVFPQGAEERMCYQCESEDEP    631 - 700
QADGSGLTTAPPTPRDSLQPSIKQRLARLQLSPDFTFTAGLAAEVAARSLSFTTMQEQTFGGEEEEQIIE    701 - 770
ENKNEIEEK                                                                 771 - 779
//

Text Mined References (17)

PMID Year Title
25792470 2015 VEZT as a novel independent prognostic factor in gastric cancer.
25678572 2015 Replication and meta-analysis of previous genome-wide association studies confirm vezatin as the locus with the strongest evidence for association with endometriosis.
24069310 2013 VEZT, a novel putative tumor suppressor, suppresses the growth and tumorigenicity of gastric cancer.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23104006 2012 Genome-wide association meta-analysis identifies new endometriosis risk loci.
21156161 2011 Down-regulation of VEZT gene expression in human gastric cancer involves promoter methylation and miR-43c.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16199027 2005 Vezatin, a protein associated to adherens junctions, is required for mouse blastocyst morphogenesis.
More...