Property Summary

NCBI Gene PubMed Count 14
PubMed Score 14.03
PubTator Score 8.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 2.6e-02
astrocytic glioma -2.000 4.9e-03
atypical teratoid / rhabdoid tumor -1.300 9.7e-03
glioblastoma -1.600 5.0e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.1e-02
medulloblastoma, large-cell -1.600 3.5e-04
nasopharyngeal carcinoma 1.400 4.5e-03
oligodendroglioma -1.600 3.8e-02
osteosarcoma 1.127 1.1e-02
ovarian cancer -1.500 1.4e-03
psoriasis -2.200 1.4e-04
tuberculosis -1.400 1.8e-05

 GO Function (1)

 GO Process (1)

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MTPEFDEEVVFENSPLYQYLQDLGHTDFEICSSLSPKTEKCTTEGQQKPPTRVLPKQGILLKVAETIKSW      1 - 70
IFFSQCNKKDDLLHKLDIGFRLDSLHTILQQEVLLQEDVELIELLDPSILSAGQSQQQENGHLPTLCSLA     71 - 140
TPNIWDLSMLFAFISLLVMLPTWWIVSSWLVWGVILFVYLVIRALRLWRTAKLQVTLKKYSVHLEDMATN    141 - 210
SRAFTNLVRKALRLIQETEVISRGFTLVSAACPFNKAGQHPSQHLIGLRKAVYRTLRANFQAARLATLYM    211 - 280
LKNYPLNSESDNVTNYICVVPFKELGLGLSEEQISEEEAHNFTDGFSLPALKVLFQLWVAQSSEFFRRLA    281 - 350
LLLSTANSPPGPLLTPALLPHRILSDVTQGLPHAHSACLEELKRSYEFYRYFETQHQSVPQCLSKTQQKS    351 - 420
RELNNVHTAVRSLQLHLKALLNEVIILEDELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQASNNCWE    421 - 490
EAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDIDSDFRKDD    491 - 560
FYYLSQEDKERQKREHEESKRVLQELKSVLGFKASEAERQKWKQLLFSDHAVLKSLSPVDPVEPISNSEP    561 - 630
SMNSDMGKVSKNDTEEESNKSATTDNEISRTEYLCENSLEGKNKDNSSNEVFPQGAEERMCYQCESEDEP    631 - 700
QADGSGLTTAPPTPRDSLQPSIKQRLARLQLSPDFTFTAGLAAEVAARSLSFTTMQEQTFGGEEEEQIIE    701 - 770
ENKNEIEEK                                                                 771 - 779
//

Text Mined References (18)

PMID Year Title