Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.01
PubTator Score 14.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 9.5e-07
tuberculosis 2010 7.0e-05
osteosarcoma 7950 7.9e-04
oligodendroglioma 2850 2.7e-02

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma -1.500 2.7e-02
osteosarcoma -1.282 7.9e-04
ovarian cancer 2.500 9.5e-07
tuberculosis 1.100 7.0e-05

Synonym

Accession Q9HBL8
Symbols HSCARG
SDR48A1

Gene

PDB

2EXX   2WM3   2WMD   3DXF   3E5M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

AA Sequence

MVDKKLVVVFGGTGAQGGSVARTLLEDGTFKVRVVTRNPRKKAAKELRLQGAEVVQGDQDDQVIMELALN      1 - 70
GAYATFIVTNYWESCSQEQEVKQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLAAAHFDGKGEVEEYF     71 - 140
RDIGVPMTSVRLPCYFENLLSHFLPQKAPDGKSYLLSLPTGDVPMDGMSVSDLGPVVLSLLKMPEKYVGQ    141 - 210
NIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYALRPDRDIELTLRLNP    211 - 280
KALTLDQWLEQHKGDFNLL                                                       281 - 299
//

Text Mined References (19)

PMID Year Title