Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.78
PubTator Score 6.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 3.63880686467988E-11
psoriasis 6685 6.45993662337647E-11
atypical teratoid/rhabdoid tumor 1095 6.7896895631449E-11
glioblastoma 5572 4.32909835423835E-7
malignant mesothelioma 3163 1.75363530088151E-6
group 3 medulloblastoma 2254 1.6630210095972E-5
pediatric high grade glioma 2712 1.9963101474299E-4
ovarian cancer 8492 0.00584214151381529

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
posterior fossa group A ependymoma 1.200 0.000
glioblastoma 1.100 0.000
group 3 medulloblastoma 1.400 0.000
atypical teratoid/rhabdoid tumor 1.500 0.000
pediatric high grade glioma 1.100 0.000
psoriasis 1.200 0.000
ovarian cancer 1.100 0.006

Synonym

Accession Q9HBL7 B2R6W0 Q9NZ44 Plg-R(KT)
Symbols AD025
MDS030
C9orf46
PLG-RKT
Plg-R(KT)

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (4)

PMID Text
21940822 Plg-R(KT) plays a key role in the plasminogen-dependent regulation of macrophage invasion, chemotactic migration, and recruitment in the inflammatory response.
21795689 Plg-R(KT) was highly expressed in bovine adrenomedullary chromaffin cells, human pheochromocytoma tissue, PC12 pheochromocytoma cells, and murine hippocampus.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTA      1 - 70
GAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQ     71 - 140
SRFFIDK                                                                   141 - 147
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21940822 2011 Regulation of macrophage migration by a novel plasminogen receptor Plg-R KT.
21795689 2011 The novel plasminogen receptor, plasminogen receptor(KT) (Plg-R(KT)), regulates catecholamine release.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19897580 2010 Proteomics-based discovery of a novel, structurally unique, and developmentally regulated plasminogen receptor, Plg-RKT, a major regulator of cell surface plasminogen activation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...