Property Summary

NCBI Gene PubMed Count 15
Grant Count 10
R01 Count 9
Funding $1,875,022.33
PubMed Score 4.78
PubTator Score 6.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
posterior fossa group A ependymoma 1.200 0.000
glioblastoma 1.100 0.000
group 3 medulloblastoma 1.400 0.000
atypical teratoid/rhabdoid tumor 1.500 0.000
pediatric high grade glioma 1.100 0.000
psoriasis 1.200 0.000
ovarian cancer 1.100 0.006

Gene RIF (4)

PMID Text
21940822 Plg-R(KT) plays a key role in the plasminogen-dependent regulation of macrophage invasion, chemotactic migration, and recruitment in the inflammatory response.
21795689 Plg-R(KT) was highly expressed in bovine adrenomedullary chromaffin cells, human pheochromocytoma tissue, PC12 pheochromocytoma cells, and murine hippocampus.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTA      1 - 70
GAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQ     71 - 140
SRFFIDK                                                                   141 - 147
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21940822 2011 Regulation of macrophage migration by a novel plasminogen receptor Plg-R KT.
21795689 2011 The novel plasminogen receptor, plasminogen receptor(KT) (Plg-R(KT)), regulates catecholamine release.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19897580 2010 Proteomics-based discovery of a novel, structurally unique, and developmentally regulated plasminogen receptor, Plg-RKT, a major regulator of cell surface plasminogen activation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...