Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.02
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8297 1.6e-05
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Hypertrichosis 45 3.997 2.0
Congenital diaphragmatic hernia 66 3.472 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.600 1.6e-05

AA Sequence

MKGELLLFSSVIVLLQVVCSCPDKCYCQSSTNFVDCSQQGLAEIPSHLPPQTRTLHLQDNQIHHLPAFAF      1 - 70
RSVPWLMTLNLSNNSLSNLAPGAFHGLQHLQVLNLTQNSLLSLESRLFHSLPQLRELDLSSNNISHLPTS     71 - 140
LGETWENLTILAVQQNQLQQLDRALLESMPSVRLLLLKDNLWKCNCHLLGLKLWLEKFVYKGGLTDGIIC    141 - 210
ESPDTWKGKDLLRIPHELYQPCPLPAPDPVSSQAQWPGSAHGVVLRPPENHNAGERELLECELKPKPRPA    211 - 280
NLRHAIATVIITGVVCGIVCLMMLAAAIYGCTYAAITAQYHGGPLAQTNDPGKVEEKERFDSSPA         281 - 345
//

Text Mined References (5)

PMID Year Title