Property Summary

NCBI Gene PubMed Count 30
PubMed Score 317.99
PubTator Score 25.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
breast carcinoma 1614 1.73941827589398E-29
lung carcinoma 2844 5.26962609031515E-23
non-small cell lung cancer 2798 3.71785025275877E-21
tuberculosis and treatment for 3 months 327 5.96850799067759E-8
malignant mesothelioma 3163 7.42335475913509E-8
osteosarcoma 7933 1.77781869252753E-6
posterior fossa group A ependymoma 1511 8.75953167815704E-6
cystic fibrosis 1670 1.56896622378564E-5
lung cancer 4473 2.06987817055845E-5
lung adenocarcinoma 2714 3.9648410347756E-5
invasive ductal carcinoma 2950 6.4007789110125E-5
group 4 medulloblastoma 1875 9.51440406015026E-5
ductal carcinoma in situ 1745 1.7262943005374E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.83580734604487E-4
psoriasis 6685 2.03616223549741E-4
dermatomyositis 967 2.42588919463203E-4
medulloblastoma, large-cell 6234 4.08377459397795E-4
atypical teratoid/rhabdoid tumor 1095 4.80038534547524E-4
ovarian cancer 8492 4.95967733670632E-4
colon cancer 1475 5.82376987623712E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.75425336882869E-4
Pick disease 1893 9.95979706691786E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00227462812335835
glioblastoma 5572 0.00315698754787169
astrocytoma 1493 0.00384507123841298
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00703869387908535
adrenocortical carcinoma 1427 0.0130246228973056
Down syndrome 548 0.0132408474846139
fibroadenoma 557 0.014657370507669
ulcerative colitis 2087 0.0165629154043005
Breast cancer 3099 0.0434874330333867
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 2.0

Expression

Synonym

Accession Q9HBL0 Q4ZG71 Q6IPI5
Symbols TNS
MXRA6
MST091
MST122
MST127
MSTP091
MSTP122
MSTP127
PPP1R155

Gene

  Ortholog (7)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (13)

PMID Text
26216473 TNS1, MET, and TRKC tyrosine-phosphorylated proteins are upregulated during epithelial-mesenchymal transition induced with TGF-beta, and predict the outcome in lung adenocarcinoma patients.
21965014 TNS1 polymorphism associated with COPD risk and lung function decline
20798394 data demonstrate that tensin1 is extensively phosphorylated on Ser/Thr residues in cells and phosphorylation by p38 MAPK regulates the specificity of the tensin1 Src homology 2 domain for binding to different proteins
20010834 Data show expression of TNS1, GSTCD, AGER, HTR4 and THSD4 in lung tissue and indicate potential targets for interventions to alleviate respiratory disease.
20010834 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19826001 Results suggest that PP1alpha bound to tensin1 has effects in reducing migration and invasion that are not mediated through DLC-1, and show the importance of PP1alpha binding to tensin1 for the regulation of cell polarization, migration, and invasion.
19664390 The expression of tensin is increased in mesangial cells with stimulating of high concentrations of glucose.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19194507 Tensins may represent a novel group of metastasis suppressors in the kidney, the loss of which leads to greater tumor cell motility and consequent metastasis.
18537817 Aged fibroblasts, generated with the Hayflick replicative senescence model, exhibit as siRNA silences fibroblasts, a reduced tensin1 expression and an impaired gel contraction capacity.
More...

AA Sequence

MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKL      1 - 70
HAKVLEFGWPDLHTPALEKICSICKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASADQA     71 - 140
LDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESKGGCRPFLRIY    141 - 210
QAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVF    211 - 280
GKEDLDDAFKDDRFPEYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHRDDGM    281 - 350
EEVVGHTQGPLDGSLYAKVKKKDSLHGSTGAVNATRPTLSATPNHVEHTLSVSSDSGNSTASTKTDKTDE    351 - 420
PVPGASSATAALSPQEKRELDRLLSGFGLEREKQGAMYHTQHLRSRPAGGSAVPSSGRHVVPAQVHVNGG    421 - 490
ALASERETDILDDELPNQDGHSAGSMGTLSSLDGVTNTSEGGYPEALSPLTNGLDKSYPMEPMVNGGGYP    491 - 560
YESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAWPQPVTTSHYAHDPSGMFRSQSFSEAEPQLP    561 - 630
PAPVRGGSSREAVQRGLNSWQQQQQQQQQPRPPPRQQERAHLESLVASRPSPQPLAETPIPSLPEFPRAA    631 - 700
SQQEIEQSIETLNMLMLDLEPASAAAPLHKSQSVPGAWPGASPLSSQPLSGSSRQSHPLTQSRSGYIPSG    701 - 770
HSLGTPEPAPRASLESVPPGRSYSPYDYQPCLAGPNQDFHSKSPASSSLPAFLPTTHSPPGPQQPPASLP    771 - 840
GLTAQPLLSPKEATSDPSRTPEEEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEA    841 - 910
TSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYKEAFEEMEGTSPSSPPPSGVRSPPGLAKTPL    911 - 980
SALGLKPHNPADILLHPTGVTRRRIQPEEDEGKVVVRLSEEPRSYVESVARTAVAGPRAQDSEPKSFSAP    981 - 1050
ATQAYGHEIPLRNGTLGGSFVSPSPLSTSSPILSADSTSVGSFPSGESSDQGPRTPTQPLLESGFRSGSL   1051 - 1120
GQPSPSAQRNYQSSSPLPTVGSSYSSPDYSLQHFSSSPESQARAQFSVAGVHTVPGSPQARHRTVGTNTP   1121 - 1190
PSPGFGWRAINPSMAAPSSPSLSHHQMMGPPGTGFHGSTVSSPQSSAATTPGSPSLCRHPAGVYQVSGLH   1191 - 1260
NKVATTPGSPSLGRHPGAHQGNLASGLHSNAIASPGSPSLGRHLGGSGSVVPGSPCLDRHVAYGGYSTPE   1261 - 1330
DRRPTLSRQSSASGYQAPSTPSFPVSPAYYPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMSVGDRAGS   1331 - 1400
LPNYATINGKVSSPVASGMSSPSGGSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISR   1401 - 1470
EQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKG   1471 - 1540
CPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTADLLKQGAACNVLFVNSVDME   1541 - 1610
SLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWMK   1611 - 1680
TEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQKR                  1681 - 1735
//

Text Mined References (41)

PMID Year Title
26216473 2015 Identification of Tyrosine-Phosphorylated Proteins Upregulated during Epithelial-Mesenchymal Transition Induced with TGF-?.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
21965014 2011 Effect of five genetic variants associated with lung function on the risk of chronic obstructive lung disease, and their joint effects on lung function.
More...