Property Summary

NCBI Gene PubMed Count 32
PubMed Score 354.45
PubTator Score 25.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (31)

Disease log2 FC p
adrenocortical carcinoma -1.171 3.7e-03
astrocytoma 3.200 3.8e-03
atypical teratoid/rhabdoid tumor -1.200 4.8e-04
autosomal dominant Emery-Dreifuss muscul... 1.047 2.3e-03
Breast cancer -2.400 4.3e-02
breast carcinoma -1.200 1.0e-03
colon cancer -2.100 1.7e-02
cystic fibrosis -1.500 1.0e-04
dermatomyositis 1.500 2.4e-04
Down syndrome 1.200 1.3e-02
ductal carcinoma in situ -1.700 1.3e-03
fibroadenoma -1.500 2.3e-02
glioblastoma 1.100 3.2e-03
group 3 medulloblastoma -1.400 2.5e-02
intraductal papillary-mucinous adenoma (... -1.600 1.1e-03
intraductal papillary-mucinous carcinoma... -1.300 1.0e-03
intraductal papillary-mucinous neoplasm ... -1.300 1.0e-03
invasive ductal carcinoma -1.800 6.8e-03
lung adenocarcinoma -1.300 1.5e-13
lung cancer -2.900 5.7e-06
lung carcinoma -2.000 5.3e-23
malignant mesothelioma 1.500 7.8e-07
medulloblastoma, large-cell -1.700 4.1e-04
non-small cell lung cancer -1.039 3.3e-13
osteosarcoma -3.005 1.8e-06
ovarian cancer -1.200 7.2e-05
Pick disease 1.300 1.0e-03
posterior fossa group A ependymoma 1.100 8.8e-06
psoriasis -1.500 4.8e-07
tuberculosis -1.300 3.5e-04
ulcerative colitis 1.100 1.7e-02

Gene RIF (15)

AA Sequence

MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKL      1 - 70
HAKVLEFGWPDLHTPALEKICSICKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASADQA     71 - 140
LDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESKGGCRPFLRIY    141 - 210
QAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVF    211 - 280
GKEDLDDAFKDDRFPEYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHRDDGM    281 - 350
EEVVGHTQGPLDGSLYAKVKKKDSLHGSTGAVNATRPTLSATPNHVEHTLSVSSDSGNSTASTKTDKTDE    351 - 420
PVPGASSATAALSPQEKRELDRLLSGFGLEREKQGAMYHTQHLRSRPAGGSAVPSSGRHVVPAQVHVNGG    421 - 490
ALASERETDILDDELPNQDGHSAGSMGTLSSLDGVTNTSEGGYPEALSPLTNGLDKSYPMEPMVNGGGYP    491 - 560
YESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAWPQPVTTSHYAHDPSGMFRSQSFSEAEPQLP    561 - 630
PAPVRGGSSREAVQRGLNSWQQQQQQQQQPRPPPRQQERAHLESLVASRPSPQPLAETPIPSLPEFPRAA    631 - 700
SQQEIEQSIETLNMLMLDLEPASAAAPLHKSQSVPGAWPGASPLSSQPLSGSSRQSHPLTQSRSGYIPSG    701 - 770
HSLGTPEPAPRASLESVPPGRSYSPYDYQPCLAGPNQDFHSKSPASSSLPAFLPTTHSPPGPQQPPASLP    771 - 840
GLTAQPLLSPKEATSDPSRTPEEEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEA    841 - 910
TSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYKEAFEEMEGTSPSSPPPSGVRSPPGLAKTPL    911 - 980
SALGLKPHNPADILLHPTGVTRRRIQPEEDEGKVVVRLSEEPRSYVESVARTAVAGPRAQDSEPKSFSAP    981 - 1050
ATQAYGHEIPLRNGTLGGSFVSPSPLSTSSPILSADSTSVGSFPSGESSDQGPRTPTQPLLESGFRSGSL   1051 - 1120
GQPSPSAQRNYQSSSPLPTVGSSYSSPDYSLQHFSSSPESQARAQFSVAGVHTVPGSPQARHRTVGTNTP   1121 - 1190
PSPGFGWRAINPSMAAPSSPSLSHHQMMGPPGTGFHGSTVSSPQSSAATTPGSPSLCRHPAGVYQVSGLH   1191 - 1260
NKVATTPGSPSLGRHPGAHQGNLASGLHSNAIASPGSPSLGRHLGGSGSVVPGSPCLDRHVAYGGYSTPE   1261 - 1330
DRRPTLSRQSSASGYQAPSTPSFPVSPAYYPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMSVGDRAGS   1331 - 1400
LPNYATINGKVSSPVASGMSSPSGGSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISR   1401 - 1470
EQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKG   1471 - 1540
CPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTADLLKQGAACNVLFVNSVDME   1541 - 1610
SLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWMK   1611 - 1680
TEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQKR                  1681 - 1735
//

Text Mined References (43)

PMID Year Title