Property Summary

NCBI Gene PubMed Count 72
Grant Count 73
R01 Count 49
Funding $16,680,922.33
PubMed Score 124.10
PubTator Score 124.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Synonym

Accession Q9HBK9 A6NP79 Q0VDK3 Q0VDK4 Q5PZ02
Symbols CYT19

Gene

PANTHER Protein Class (2)

Gene RIF (71)

PMID Text
26411936 Its genotype-dependent differences in arsenic metabolism is noted.(review)
26366667 a strong signal of positive selection in the main arsenic methyltransferase AS3MT gene, which has been previously associated with lower concentrations of the most toxic product of arsenic metabolism monomethylarsonic acid.
26209557 genome-wide association study in population in United States (AZ, OK, SD, ND): Data suggest SNPs in AS3MT (rs17878846, rs10509760) partly explain inter-individual variability in susceptibility to arsenic poisoning (and urine arsenic species patterns).
25491248 The present study found that rs3740400 in As3MT and rs156697 in GSTO2 were strongly associated with the arsenic species (%iAs, %MMA and MMA/iAs and DMA/MMA ratios) in urine of the occupationally exposed workers and they may influence methylation capacity.
25461954 This study's results provide preliminary evidence for the over-transmission of the A allele at the AS3MT rs11191454 polymorphism in Attention Deficit Hyperactivity Disorder.
25447140 Functions of arsenic (III) methyltransferase S-adenosylmethionine binding site were evaluated.
25349987 analysis of the functional roles of GSH and the crucial Cys residues in iAs3+ methylation catalyzed by hAS3MT
25156000 Genetic variation in AS3MT gene is associated with arsenic metabolism and risk of basal cell carcinoma.
24845704 Influence of the level of arsenic exposure and the presence of T860C polymorphism in human As urinary metabolic profile
24792412 polymorphisms may impact disease susceptibility [review]
More...

AA Sequence

MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLE      1 - 70
NCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLG     71 - 140
EAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGA    141 - 210
LYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGIT    211 - 280
GHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLA    281 - 350
EESDSMKSRCVPDAAGGCCGTKKSC                                                 351 - 375
//

Text Mined References (76)

PMID Year Title
26411936 2015 [Relationship between Arsenic (+3 Oxidation State) Methyltransferase Genetic Polymorphisms and Methylation Capacity of Inorganic Arsenic].
26366667 2015 Positive selection of AS3MT to arsenic water in Andean populations.
26209557 2015 Linkage Analysis of Urine Arsenic Species Patterns in the Strong Heart Family Study.
25491248 2015 Biological monitoring and the influence of genetic polymorphism of As3MT and GSTs on distribution of urinary arsenic species in occupational exposure workers.
25461954 2015 Family-based association study of the arsenite methyltransferase gene (AS3MT, rs11191454) in Korean children with attention-deficit hyperactivity disorder.
25447140 2014 Mutational analysis of residues in human arsenic (III) methyltransferase (hAS3MT) belonging to 5 Å around S-adenosylmethionine (SAM).
25349987 2014 The functions of crucial cysteine residues in the arsenite methylation catalyzed by recombinant human arsenic (III) methyltransferase.
25156000 2015 Genetic variation in arsenic (+3 oxidation state) methyltransferase (AS3MT), arsenic metabolism and risk of basal cell carcinoma in a European population.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
More...