Property Summary

NCBI Gene PubMed Count 79
PubMed Score 132.69
PubTator Score 124.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 5.5e-14

Gene RIF (78)

AA Sequence

MAALRDAEIQKDVQTYYGQVLKRSADLQTNGCVTTARPVPKHIREALQNVHEEVALRYYGCGLVIPEHLE      1 - 70
NCWILDLGSGSGRDCYVLSQLVGEKGHVTGIDMTKGQVEVAEKYLDYHMEKYGFQASNVTFIHGYIEKLG     71 - 140
EAGIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLELPEEIRTHKVLWGECLGGA    141 - 210
LYWKELAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGIT    211 - 280
GHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLA    281 - 350
EESDSMKSRCVPDAAGGCCGTKKSC                                                 351 - 375
//

Text Mined References (83)

PMID Year Title