Property Summary

NCBI Gene PubMed Count 5
Grant Count 16
R01 Count 11
Funding $1,304,458.34
PubMed Score 12.78
PubTator Score 10.60

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (1)

PMID Text
24632611 USP29 interacts with Claspin and is able to deubiquitinate it both in vivo and in vitro.

AA Sequence

MISLKVCGFIQIWSQKTGMTKLKEALIETVQRQKEIKLVVTFKSGKFIRIFQLSNNIRSVVLRHCKKRQS      1 - 70
HLRLTLKNNVFLFIDKLSYRDAKQLNMFLDIIHQNKSQQPMKSDDDWSVFESRNMLKEIDKTSFYSICNK     71 - 140
PSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTNEDILKEDNPVPNKKYKTDSLKYIQSNRKNP    141 - 210
SSLEDLEKDRDLKLGPSFNTNCNGNPNLDETVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHS    211 - 280
QQLQQGFPNLGNTCYMNAVLQSLFAIPSFADDLLTQGVPWEYIPFEALIMTLTQLLALKDFCSTKIKREL    281 - 350
LGNVKKVISAVAEIFSGNMQNDAHEFLGQCLDQLKEDMEKLNATLNTGKECGDENSSPQMHVGSAATKVF    351 - 420
VCPVVANFEFELQLSLICKACGHAVLKVEPNNYLSINLHQETKPLPLSIQNSLDLFFKEEELEYNCQMCK    421 - 490
QKSCVARHTFSRLSRVLIIHLKRYSFNNAWLLVKNNEQVYIPKSLSLSSYCNESTKPPLPLSSSAPVGKC    491 - 560
EVLEVSQEMISEINSPLTPSMKLTSESSDSLVLPVEPDKNADLQRFQRDCGDASQEQHQRDLENGSALES    561 - 630
ELVHFRDRAIGEKELPVADSLMDQGDISLPVMYEDGGKLISSPDTRLVEVHLQEVPQHPELQKYEKTNTF    631 - 700
VEFNFDSVTESTNGFYDCKENRIPEGSQGMAEQLQQCIEESIIDEFLQQAPPPGVRKLDAQEHTEETLNQ    701 - 770
STELRLQKADLNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMGDPLQAYRLISVVSHIGSSPNSGH    771 - 840
YISDVYDFQKQAWFTYNDLCVSEISETKMQEARLHSGYIFFYMHNGIFEELLRKAENSRLPSTQAGVIPQ    841 - 910
GEYEGDSLYRPA                                                              911 - 922
//

Text Mined References (5)

PMID Year Title
24632611 2015 USP29 controls the stability of checkpoint adaptor Claspin by deubiquitination.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10958632 2000 Discovery of a novel, paternally expressed ubiquitin-specific processing protease gene through comparative analysis of an imprinted region of mouse chromosome 7 and human chromosome 19q13.4.