Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.60
PubTator Score 7.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -1.400 6.6e-04
cystic fibrosis 1.300 5.7e-04
interstitial cystitis -1.800 1.0e-03
lung cancer 2.500 6.4e-04
non-small cell lung cancer 1.685 1.1e-05
pancreatic ductal adenocarcinoma liver m... -1.458 6.9e-03
psoriasis 2.100 8.6e-25
urothelial carcinoma -1.500 3.0e-02

Gene RIF (7)

AA Sequence

MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWFWGHQGLVTPT      1 - 70
EEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSG     71 - 140
GDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLDSLQKCVFSF    141 - 210
ESNCQEKPSEYIAAILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPT    211 - 280
QGIDDFLKNKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEY    281 - 350
QEQCRQEVQELLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVC    351 - 420
LINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFR    421 - 490
ILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ                                        491 - 524
//

Text Mined References (17)

PMID Year Title