Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.23
PubTator Score 7.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 8.5703464959562E-25
cystic fibrosis 1670 8.10227546841711E-7
lung cancer 4473 6.7710842094486E-6
non-small cell lung cancer 2798 1.11783138032014E-5
interstitial cystitis 2299 3.56391160559061E-5
Breast cancer 3099 6.63619860912939E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0068979971633013
urothelial carcinoma 318 0.0300449388718076

Expression

  Differential Expression (8)

Disease log2 FC p
urothelial carcinoma -1.500 0.030
pancreatic ductal adenocarcinoma liver m... -1.458 0.007
non-small cell lung cancer 1.685 0.000
lung cancer 4.400 0.000
interstitial cystitis -1.900 0.000
cystic fibrosis 2.800 0.000
Breast cancer -1.400 0.001
psoriasis 2.100 0.000

Synonym

Accession Q9HBI6 A0A024R7G0 A8K059 O75254 Q96AQ5
Symbols CYPIVF11

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
24138531 Microsomal menaquinone-4 omega-hydroxylation activities correlated with the CYP4F2 V433M genotype but not the CYP4F11 D446N genotype
20689807 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19812349 The CYP4F11 gene is positively regulated by multiple signaling pathways in HaCaT keratinocytes, including retinoid X receptor and JNK signaling pathways.
18976975 Knockdown of cytochrome P450, family 4, subfamily F, polypeptide 11 (CYP4F11) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18065749 3-hydroxystearate and 3-hydroxypalmitate are converted to omega-hydroxylated 3-OHDCA precursors in liver; CYP4F11 and, to a lesser extent, CYP4F2 catalyzed omega-hydroxylation of 3-hydroxystearate; CYP4F3b, CYP4F12, and CYP4A11 had negligible activity.

AA Sequence

MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWFWGHQGLVTPT      1 - 70
EEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSG     71 - 140
GDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLDSLQKCVFSF    141 - 210
ESNCQEKPSEYIAAILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPT    211 - 280
QGIDDFLKNKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEY    281 - 350
QEQCRQEVQELLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVC    351 - 420
LINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFR    421 - 490
ILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ                                        491 - 524
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24138531 2013 Cytochrome P450-dependent catabolism of vitamin K: ?-hydroxylation catalyzed by human CYP4F2 and CYP4F11.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19932081 2010 Human cytochrome P450 4F11: heterologous expression in bacteria, purification, and characterization of catalytic function.
19812349 2010 Gene regulation of CYP4F11 in human keratinocyte HaCaT cells.
18065749 2008 Omega oxidation of 3-hydroxy fatty acids by the human CYP4F gene subfamily enzyme CYP4F11.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364545 2004 Expression and characterization of human cytochrome P450 4F11: Putative role in the metabolism of therapeutic drugs and eicosanoids.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
More...