Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.27
PubTator Score 0.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
astrocytic glioma -2.600 0.014
ependymoma -2.000 0.008
oligodendroglioma -2.200 0.048
esophageal adenocarcinoma -1.500 0.033
glioblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.100 0.000
lung cancer 1.900 0.000
breast carcinoma 1.400 0.000
interstitial cystitis -1.500 0.001
adult high grade glioma -1.900 0.001
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.119 0.031
lung carcinoma 3.200 0.000
ductal carcinoma in situ 2.500 0.001
invasive ductal carcinoma 2.500 0.001
acute myeloid leukemia -1.400 0.029
ulcerative colitis 1.100 0.002
ovarian cancer -1.800 0.000

Synonym

Accession Q9HBI5 B2R9U0
Symbols HT021

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTSLFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSLQT      1 - 70
RIHPLPRPEVVSLETRYWASVEEYIPKWEQFLLGRAPYPFAVENQNEAENTIQNEAQR                 71 - 128
//

Text Mined References (7)

PMID Year Title
21156036 2010 DNA methylation in glioblastoma: impact on gene expression and clinical outcome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.