Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.27
PubTator Score 0.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.23206083131944E-35
malignant mesothelioma 3163 7.48806823378921E-7
pilocytic astrocytoma 3086 2.57364696803414E-6
atypical teratoid / rhabdoid tumor 4369 3.10069720620358E-6
glioblastoma 5572 3.2141108954746E-6
ovarian cancer 8492 1.04080425869185E-5
medulloblastoma, large-cell 6234 3.23810219954546E-5
breast carcinoma 1614 7.59644748549428E-5
lung cancer 4473 4.74698117255297E-4
ductal carcinoma in situ 1745 5.86902277083168E-4
interstitial cystitis 2299 6.37140501116978E-4
adult high grade glioma 2148 8.32206089649932E-4
invasive ductal carcinoma 2950 0.00105110054094299
ulcerative colitis 2087 0.00157755313728748
ependymoma 2514 0.00801636428594672
astrocytic glioma 2241 0.0137005255483945
acute myeloid leukemia 785 0.0294301780523749
subependymal giant cell astrocytoma 2287 0.0307332648006032
esophageal adenocarcinoma 737 0.0326835104414524
oligodendroglioma 2849 0.0479362593461158

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
astrocytic glioma -2.600 0.014
ependymoma -2.000 0.008
oligodendroglioma -2.200 0.048
esophageal adenocarcinoma -1.500 0.033
glioblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.100 0.000
lung cancer 1.900 0.000
breast carcinoma 1.400 0.000
interstitial cystitis -1.500 0.001
adult high grade glioma -1.900 0.001
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.119 0.031
lung carcinoma 3.200 0.000
ductal carcinoma in situ 2.500 0.001
invasive ductal carcinoma 2.500 0.001
acute myeloid leukemia -1.400 0.029
ulcerative colitis 1.100 0.002
ovarian cancer -1.800 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTSLFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKRNLSLLKDIEAAEKSLQT      1 - 70
RIHPLPRPEVVSLETRYWASVEEYIPKWEQFLLGRAPYPFAVENQNEAENTIQNEAQR                 71 - 128
//

Text Mined References (7)

PMID Year Title
21156036 2010 DNA methylation in glioblastoma: impact on gene expression and clinical outcome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.