Property Summary

NCBI Gene PubMed Count 46
PubMed Score 16.68
PubTator Score 18.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis -1.600 0.012
oligodendroglioma -1.300 0.001
psoriasis -1.500 0.000
osteosarcoma -1.872 0.000
glioblastoma 1.300 0.004
intraductal papillary-mucinous carcinoma... -1.100 0.001
active ulcerative colitis 1.330 0.037
interstitial cystitis 1.300 0.029
adult high grade glioma -1.100 0.002
spina bifida 1.126 0.040
ovarian cancer 1.100 0.000
dermatomyositis -1.600 0.000

Gene RIF (24)

PMID Text
26549231 Taken together, our results indicate that 24-MCF treatment increases parvin-beta expression, which may inhibit ILK downstream signaling.
26343796 study found polymorphisms of rs5764455 and rs6006473 in PARVB gene in the Han Chinese population, and these polymorphisms were associated with the occurrence and progression of NAFLD.
26115385 Protein expression of beta-Parvin increases with colorectal cancer progression.
25776890 PARVB protein
25422907 PARVB overexpression is a candidate biomarker for endophytic tumours and metastasis.
24621583 Our results suggested that variations, including insertion/deletions, in PARVB, as well as those in PNPLA3, are important in the progression of NAFLD.
23950981 PARVB plays a potential role in the pathogenesis of coronary restenosis.
23535911 Polymorphisms in the SAMM50 and PARVB genes in addition to those in the PNPLA3 gene were observed to be associated with the development and progression of NAFLD.
23099104 alpha-parvin, beta-parvin and migfilin were expressed in tumor cells in 53%, 2%, 28% and 53% of effusions and 57%, 20%, 83% and 25% of solid lesions, respectively.
22869380 proper localization of beta-parvin to focal adhesions requires both the paxillin and integrin-linked kinase binding sites and that paxillin is important for early targeting of beta-parvin.
More...

AA Sequence

MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDVHPEDTQLEEN      1 - 70
EERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQ     71 - 140
SEIGQKQKLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVV    141 - 210
RKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELET    211 - 280
QFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTL    281 - 350
RVLYNLFTKYKNVE                                                            351 - 364
//

Text Mined References (51)

PMID Year Title
26549231 2015 24-Methylenecycloartanyl ferulate, a major compound of ?-oryzanol, promotes parvin-beta expression through an interaction with peroxisome proliferator-activated receptor-gamma 2 in human breast cancer cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26343796 2016 Association of rs5764455 and rs6006473 polymorphisms in PARVB with liver damage of nonalcoholic fatty liver disease in Han Chinese population.
26115385 2015 Focal Adhesion Proteins ?- and ?-Parvin are Overexpressed in Human Colorectal Cancer and Correlate with Tumor Progression.
25776890 2015 Targeted-bisulfite sequence analysis of the methylation of CpG islands in genes encoding PNPLA3, SAMM50, and PARVB of patients with non-alcoholic fatty liver disease.
25422907 2015 PARVB overexpression increases cell migration capability and defines high risk for endophytic growth and metastasis in tongue squamous cell carcinoma.
25117820 2014 Genetic variant predicts bevacizumab-induced hypertension in ECOG-5103 and ECOG-2100.
24621583 2014 Targeted next-generation sequencing and fine linkage disequilibrium mapping reveals association of PNPLA3 and PARVB with the severity of nonalcoholic fatty liver disease.
23950981 2013 Pathway analysis using genome-wide association study data for coronary restenosis--a potential role for the PARVB gene.
23535911 2013 Genome-wide scan revealed that polymorphisms in the PNPLA3, SAMM50, and PARVB genes are associated with development and progression of nonalcoholic fatty liver disease in Japan.
More...