Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.92
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
group 3 medulloblastoma -1.100 1.3e-04
interstitial cystitis 1.800 2.3e-03
invasive ductal carcinoma 1.009 4.3e-05
lung carcinoma -2.000 8.2e-25
non-small cell lung cancer -1.522 6.7e-16
osteosarcoma -3.289 1.5e-06
primary Sjogren syndrome 1.100 1.2e-03
Rheumatoid arthritis -1.200 4.8e-03
subependymal giant cell astrocytoma 1.272 1.6e-02
tuberculosis 1.200 2.4e-08

Gene RIF (4)

AA Sequence

MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEE      1 - 70
DMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTL     71 - 140
HLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVN    141 - 210
AVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALE    211 - 280
LLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN                       281 - 331
//

Text Mined References (17)

PMID Year Title