Property Summary

NCBI Gene PubMed Count 15
Grant Count 3
Funding $102,302.9
PubMed Score 5.81
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.005
osteosarcoma -3.537 0.000
tuberculosis 1.300 0.000
non-small cell lung cancer -1.522 0.000
interstitial cystitis 1.800 0.002
group 3 medulloblastoma -1.100 0.000
primary Sjogren syndrome 1.100 0.001
subependymal giant cell astrocytoma 1.272 0.016
invasive ductal carcinoma 1.009 0.000
lung carcinoma -2.000 0.000

Gene RIF (4)

PMID Text
23146538 Suggest role for PARVG gene polymorphisms in operational renal allograft tolerance.
16517730 integrin-linked kinase-gamma-parvin complex is critically involved in the initial integrin signaling for leukocyte migration
15993274 INI1hSNF5 and PARVG do not seem to be the tumor suppressor genes involved in oligodendroglioma development and progression
11722847 Mammalian parvins are likely to have arisen late in evolution from gene duplication as they share a remarkably similar exon/intron organization.

AA Sequence

MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEE      1 - 70
DMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTL     71 - 140
HLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVN    141 - 210
AVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALE    211 - 280
LLKDEGLLSCPVSPEDIVNKDAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN                       281 - 331
//

Text Mined References (17)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23146538 2012 PARVG gene polymorphism and operational renal allograft tolerance.
16517730 2006 The gamma-parvin-integrin-linked kinase complex is critically involved in leukocyte-substrate interaction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15993274 2005 No evidence of INI1hSNF5 (SMARCB1) and PARVG point mutations in oligodendroglial neoplasms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
More...