Property Summary

NCBI Gene PubMed Count 28
PubMed Score 17.08
PubTator Score 19.52

Knowledge Summary

Patent (8,726)

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.069 0.005
psoriasis -1.200 0.000
osteosarcoma -2.756 0.000
astrocytoma 2.100 0.001
glioblastoma 1.500 0.023
group 4 medulloblastoma -1.400 0.000
primary pancreatic ductal adenocarcinoma -1.245 0.001
Parkinson's disease 1.100 0.024
spina bifida -1.520 0.036
ovarian cancer 1.800 0.000
pituitary cancer -1.600 0.000
pancreatic cancer -1.400 0.000

 MGI Term (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (12)

PMID Text
26668315 Data suggest MNK1/MNK2 stimulate mRNA translation but only of mRNA containing both 5-prime-terminal cap and hairpin duplex; this stimulation involves up-regulation of phosphorylation/mRNA un-winding activity of eIF4E (via decreased binding to eIF4G).
26147685 Data show that interferon-gamma regulated the metabolism and mRNA translation of macrophages by targeting the kinases mTORC1 and MNK1/2, both of which converge on the selective regulator of translation initiation eukaryotic initiation factor-4E (eIF4E).
25527453 Data suggest that a combined pharmacologic inhibition of mTORC1 and Mnk1/2 kinases offers a therapeutic opportunity in blast crisis-chronic myeloid leukemia (BC-CML).
25403230 MNK1 and MNK2 inhibition ablates eIF4E1 phosphorylation and concurrently enhances eIF4E3 expression in diffuse large B-cell lymphoma.
25193863 Provide evidence for the existence of a Mnk2/eIF4E-controlled feedback loop in medulloblastoma cells that accounts for resistance to mTORC1 inhibitors.
23831578 eIF4E phosphorylation is enhanced by Rapamycin, which activates Mnk2a
23814052 These findings provide evidence for key and essential roles of the Mnk kinase pathway in the generation of the antineoplastic effects of type I IFNs in Jak2V617F-dependent myeloproliferative neoplasms.
22797067 MNK2-dependent phosphorylation of eIF4E represents a novel drug resistance, pro-survival pathway in pancreatic ductal carcinoma.
21149447 siRNA-mediated Mnk1/2 knockdown results in partial reversal of the suppressive effects of IFNgamma on human CD34+-derived myeloid (CFU-GM) and erythroid (BFU-E) progenitors.
16856496 Mnk2 can interact with CBC(VHL) complex, and is probably one of the new substrates of the CBC(VHL) complex.
More...

AA Sequence

MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGR      1 - 70
ATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFREVEMLYQCQGHR     71 - 140
NVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFLHNKGIAHRDLKPEN    141 - 210
ILCEHPNQVSPVKICDFDLGSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWS    211 - 280
LGVILYILLSGYPPFVGRCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLV    281 - 350
RDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAG    351 - 420
QGQPVLVRATSRCLQLSPPSQSKLAQRRQRASLSSAPVVLVGDHA                             421 - 465
//

Text Mined References (40)

PMID Year Title
26668315 2016 Inhibition of Mitogen-activated Protein Kinase (MAPK)-interacting Kinase (MNK) Preferentially Affects Translation of mRNAs Containing Both a 5'-Terminal Cap and Hairpin.
26147685 2015 Interferon-? regulates cellular metabolism and mRNA translation to potentiate macrophage activation.
25527453 2015 Pharmacologic co-inhibition of Mnks and mTORC1 synergistically suppresses proliferation and perturbs cell cycle progression in blast crisis-chronic myeloid leukemia cells.
25403230 2014 MNKs act as a regulatory switch for eIF4E1 and eIF4E3 driven mRNA translation in DLBCL.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25193863 2014 Regulatory effects of a Mnk2-eIF4E feedback loop during mTORC1 targeting of human medulloblastoma cells.
23831578 2013 Rapamycin enhances eIF4E phosphorylation by activating MAP kinase-interacting kinase 2a (Mnk2a).
23814052 2013 Essential role for the Mnk pathway in the inhibitory effects of type I interferons on myeloproliferative neoplasm (MPN) precursors.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...