Property Summary

Ligand Count 104
NCBI Gene PubMed Count 29
PubMed Score 19.52
PubTator Score 19.52

Knowledge Summary

Patent (8,726)

TINX Plot

  Disease (2)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 2.100 6.3e-04
glioblastoma 1.500 2.3e-02
group 4 medulloblastoma -1.400 3.4e-04
Multiple myeloma 1.069 5.3e-03
osteosarcoma -2.756 6.4e-06
ovarian cancer -1.500 6.1e-05
pancreatic cancer -1.400 1.3e-04
Parkinson's disease 1.100 2.4e-02
pituitary cancer -1.600 1.7e-06
primary pancreatic ductal adenocarcinoma -1.245 1.3e-03
psoriasis -1.200 2.0e-04
spina bifida -1.520 3.6e-02

 MGI Phenotype (1)

Gene RIF (13)

AA Sequence

MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGR      1 - 70
ATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFREVEMLYQCQGHR     71 - 140
NVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFLHNKGIAHRDLKPEN    141 - 210
ILCEHPNQVSPVKICDFDLGSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWS    211 - 280
LGVILYILLSGYPPFVGRCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLV    281 - 350
RDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAG    351 - 420
QGQPVLVRATSRCLQLSPPSQSKLAQRRQRASLSSAPVVLVGDHA                             421 - 465
//

Text Mined References (41)

PMID Year Title