Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 5
Funding $366,597.52
PubMed Score 22.94
PubTator Score 12.56

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26046670 loss of BEX1 expression in FLT3-ITD driven AML potentiates oncogenic signaling and leads to decreased overall survival
25612294 Bex family members play important roles in the formation of protein network hubs.
24626299 Our results revealed an interaction between BEX1 and BCL-2 and a novel mechanism of imatinib resistance mediated by the BEX1/BCL-2 pathway.
24333734 Epigenetic inactivation of BEX1 supports its role as a candidate tumour suppressor gene in intracranial ependymoma
23362108 Silencing of BEX1 and LDOC1 by promoter hypermethylation might represent a critical event in the molecular pathogenesis of oral squamous cell carcinoma (OSCC) and the male predominance of OSCC occurrence.
19028701 expression of hBex1 in leukemic cells is a novel mechanism by which chemoresistance is achieved and suggests that hBex1 is a potential molecular target for the development of novel leukemia treatments
16818640 Two novel brain expressed genes, BEX1 and BEX2 are identified; they are silenced in all glioma specimens and exhibit extensive promoter hypermethylation.
11989783 This new human gene is mapped to the X chromosome and has an expression pattern of a spermatogenesis-related gene.

AA Sequence

MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRL      1 - 70
GEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP                    71 - 125
//

Text Mined References (18)

PMID Year Title
26046670 2015 BEX1 acts as a tumor suppressor in acute myeloid leukemia.
25612294 2015 Brain expressed and X-linked (Bex) proteins are intrinsically disordered proteins (IDPs) and form new signaling hubs.
25416956 2014 A proteome-scale map of the human interactome network.
24626299 2014 BEX1 promotes imatinib-induced apoptosis by binding to and antagonizing BCL-2.
24333734 2014 Epigenetic genome-wide analysis identifies BEX1 as a candidate tumour suppressor gene in paediatric intracranial ependymoma.
23362108 2013 Epigenetic regulation of the X-linked tumour suppressors BEX1 and LDOC1 in oral squamous cell carcinoma.
19028701 2009 Inhibition of apoptosis by downregulation of hBex1, a novel mechanism, contributes to the chemoresistance of Bcr/Abl+ leukemic cells.
16818640 2006 Genome-wide analysis of epigenetic silencing identifies BEX1 and BEX2 as candidate tumor suppressor genes in malignant glioma.
16314316 2005 Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
More...