Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.51
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Retinoschisis 10 4.455 2.2

Expression

Synonym

Accession Q9HBH5
Symbols PAN2
SDR7C4

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MAVATAAAVLAALGGALWLAARRFVGPRVQRLRRGGDPGLMHGKTVLITGANSGLGRATAAELLRLGARV      1 - 70
IMGCRDRARAEEAAGQLRRELRQAAECGPEPGVSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLI     71 - 140
NNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDLNSEQS    141 - 210
YNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPV    211 - 280
EGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGLLK                  281 - 336
//

Text Mined References (20)

PMID Year Title