Property Summary

NCBI Gene PubMed Count 14
Grant Count 26
R01 Count 18
Funding $3,789,519.83
PubMed Score 39.46
PubTator Score 233.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
24675470 c-myc regulated the expression of human PDF.
23815882 This is the first report showing that PDF is over-expressed in breast, colon, and lung cancers
22554513 these data reveals that PDF has several transcription start sites, the most important of which only 18 bp from the initiation codon.
21805148 the origin, evolution and preservation of the COG8/PDF same-strand overlap follow similar mechanistic steps as those documented for antisense overlaps where gain and/or loss of splice sites and polyadenylation signals seems to drive the process.
19236878 Despite the lack of true S2' and S3' binding pockets, confirmed through peptide binding modeling, enzyme kinetics suggest a combined contribution from P2'and P3' positions of a formylated peptide substrate to turnover.
19064571 Observational study of gene-disease association. (HuGE Navigator)
14637138 The inhibition of HsPDF may provide an explanation for the mechanism by which actinonin is cytotoxic against various human tumor cell lines.

AA Sequence

MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQV      1 - 70
GDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQR     71 - 140
ALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAAR    141 - 210
IIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND                                         211 - 243
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24675470 2014 Inhibition of human mitochondrial peptide deformylase causes apoptosis in c-myc-overexpressing hematopoietic cancers.
23815882 2013 Overexpression of peptide deformylase in breast, colon, and lung cancers.
22554513 2012 Transcriptional regulation of the human mitochondrial peptide deformylase (PDF).
21805148 2012 Successful COG8 and PDF overlap is mediated by alterations in splicing and polyadenylation signals.
19236878 2009 Structure and activity of human mitochondrial peptide deformylase, a novel cancer target.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
15489958 2004 Human mitochondrial peptide deformylase, a new anticancer target of actinonin-based antibiotics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14637138 2003 A new human peptide deformylase inhibitable by actinonin.
More...