Property Summary

Ligand Count 30
NCBI Gene PubMed Count 15
PubMed Score 40.84
PubTator Score 233.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQV      1 - 70
GDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQR     71 - 140
ALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAAR    141 - 210
IIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND                                         211 - 243
//

Text Mined References (16)

PMID Year Title