Property Summary

NCBI Gene PubMed Count 13
PubMed Score 19.05
PubTator Score 175.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.300 1.3e-04
Astrocytoma, Pilocytic -1.500 1.0e-09
cutaneous lupus erythematosus 1.400 4.7e-03
cystic fibrosis 1.100 2.6e-04
ependymoma -1.100 8.0e-03
glioblastoma -1.200 1.6e-09
group 3 medulloblastoma -1.200 3.7e-03
interstitial cystitis 1.300 1.5e-03
intraductal papillary-mucinous neoplasm ... 2.300 1.4e-03
invasive ductal carcinoma 1.300 1.0e-03
lung cancer -1.100 3.4e-04
lung carcinoma -1.400 5.6e-21
malignant mesothelioma 3.700 2.0e-09
medulloblastoma, large-cell -1.600 3.1e-06
osteosarcoma -2.888 1.3e-07
primitive neuroectodermal tumor -1.400 2.3e-06
psoriasis -1.600 2.7e-03
spina bifida -1.346 4.6e-02

Protein-protein Interaction (3)

Gene RIF (7)

AA Sequence

MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLN      1 - 70
LYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKE     71 - 140
QLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKRRLCLL    141 - 210
L//

Text Mined References (14)

PMID Year Title