Property Summary

NCBI Gene PubMed Count 13
PubMed Score 18.16
PubTator Score 175.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma 3.700 0.000
posterior fossa group B ependymoma -1.600 0.000
cutaneous lupus erythematosus 1.400 0.005
psoriasis -1.600 0.003
osteosarcoma -2.888 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.400 0.000
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.400 0.000
intraductal papillary-mucinous neoplasm ... 2.300 0.001
lung cancer -1.100 0.000
interstitial cystitis 1.500 0.001
cystic fibrosis 1.100 0.000
adult high grade glioma -1.300 0.000
pilocytic astrocytoma -1.600 0.000
lung carcinoma -1.400 0.000
spina bifida -1.678 0.046
invasive ductal carcinoma 1.300 0.001

Synonym

Accession Q9HBH0 Q8WVB1 Q9NXH6
Symbols RIF
ARHF

Gene

Gene RIF (7)

PMID Text
25668492 Rif has two separate roles in FARP1 regulation-in controlling its association with plexinA4, and in releasing active RhoA from a plexinA4/FARP1 complex.
22721673 HIV-1 Nef enhances the expression of ras homolog family member F (RIF) in human podocyte
22260703 In the present review, our aim is to summarize the current information about the Rif effectors and how Rif remodels actin cytoskeleton in many aspects. [Review]
22251971 The authors show that enteropathogenic Escherichia coli translocates EspH, which inactivates mammalian RhoGEFs and triggers cytotoxicity.
20233848 Rif GTPase is an alternative trigger of stress-fiber formation in epithelial cells.
18663754 deletion of genes RHOF in early-stage mycosis fungoides.
11084341 The protein encoded by this gene causes the formation of long, actin-rich filopodia. In combination with RAC1 and CDC42 it causes additional actin rearrangments, suggesting that this protein is intimately involved in regulation of the cytoskeleton.

AA Sequence

MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLN      1 - 70
LYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKE     71 - 140
QLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKKRRLCLL    141 - 210
L//

Text Mined References (14)

PMID Year Title
25668492 2015 The Rif GTPase regulates cytoskeletal signaling from plexinA4 to promote neurite retraction.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22260703 2012 The small Rho GTPase Rif and actin cytoskeletal remodelling.
22251971 2012 The interplay between the Escherichia coli Rho guanine nucleotide exchange factor effectors and the mammalian RhoGEF inhibitor EspH.
20233848 2010 The small GTPase Rif is an alternative trigger for the formation of actin stress fibers in epithelial cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18663754 2008 Array-based comparative genomic hybridization in early-stage mycosis fungoides: recurrent deletion of tumor suppressor genes BCL7A, SMAC/DIABLO, and RHOF.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...