Property Summary

NCBI Gene PubMed Count 3
Grant Count 2
Funding $900,000
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.300 0.001
osteosarcoma -3.016 0.000
primitive neuroectodermal tumor 1.700 0.000

Synonym

Accession Q9HBF5
Symbols HCCS-1

Gene

PANTHER Protein Class (1)

 Grant Application (2)

AA Sequence

MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLTK      1 - 70
TIANTYFYF                                                                  71 - 79
//

Text Mined References (4)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
11857354 2002 Candidate tumor suppressor, HCCS-1, is downregulated in human cancers and induces apoptosis in cervical cancer.