Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.71
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.4e-06
primitive neuroectodermal tumor 3035 2.1e-04
psoriasis 6694 1.0e-03
Disease Target Count Z-score Confidence
Tularemia 23 4.835 2.4
Q fever 15 4.657 2.3
Brugada syndrome 29 3.89 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.016 3.4e-06
primitive neuroectodermal tumor 1.700 2.1e-04
psoriasis -2.300 1.0e-03

Synonym

Accession Q9HBF5
Symbols HCCS-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLTK      1 - 70
TIANTYFYF                                                                  71 - 79
//

Text Mined References (4)

PMID Year Title