Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
Funding $446,350
PubMed Score 119.38
PubTator Score 40.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.100 0.004
oligodendroglioma 1.200 0.002
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.300 0.000
medulloblastoma 1.100 0.005
medulloblastoma, large-cell -1.600 0.000
ovarian cancer -2.200 0.000

Synonym

Accession Q9HBF4 J3KNL9 Q8WYX7 Q96K57 Q9BXP9 Q9HCI3
Symbols SR3
DFCP1
TAFF1
ZNFN2A1
PPP1R172

Gene

AA Sequence

MSAQTSPAEKGLNPGLMCQESYACSGTDEAIFECDECCSLQCLRCEEELHRQERLRNHERIRLKPGHVPY      1 - 70
CDLCKGLSGHLPGVRQRAIVRCQTCKINLCLECQKRTHSGGNKRRHPVTVYNVSNLQESLEAEEMDEETK     71 - 140
RKKMTEKVVSFLLVDENEEIQVTNEEDFIRKLDCKPDQHLKVVSIFGNTGDGKSHTLNHTFFYGREVFKT    141 - 210
SPTQESCTVGVWAAYDPVHKVAVIDTEGLLGATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFL    211 - 280
GDASEAYLKHFTKELKATTARCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRF    281 - 350
PEAFSSIHYKGTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSS    351 - 420
FFPDEYFTCSSLCLSCGVGCKKSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSA    421 - 490
STDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIVHVWPGTDGFLKDNNNAAQRL    491 - 560
LDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNKCATSFKDNDTKHHCRACGEGFCDS    561 - 630
CSSKTRPVPERGWGPAPVRVCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPL    631 - 700
GLVKDAARPAYWVPDHEILHCHNCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNC    701 - 770
NKKPGDL                                                                   771 - 777
//

Text Mined References (17)

PMID Year Title
25578879 2015 PI(5)P regulates autophagosome biogenesis.
23455425 2013 Autophagosomes form at ER-mitochondria contact sites.
22456507 2012 Dynamic and transient interactions of Atg9 with autophagosomes, but not membrane integration, are required for autophagy.
22178386 2012 TRIM13 regulates ER stress induced autophagy and clonogenic ability of the cells.
19898463 2009 A subdomain of the endoplasmic reticulum forms a cradle for autophagosome formation.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...