Property Summary

NCBI Gene PubMed Count 16
PubMed Score 119.38
PubTator Score 40.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.100 4.4e-03
oligodendroglioma 1.200 1.9e-03
atypical teratoid / rhabdoid tumor 1.100 2.0e-05
glioblastoma 1.300 2.2e-05
medulloblastoma 1.100 5.3e-03
medulloblastoma, large-cell -1.600 1.9e-05
ovarian cancer -2.200 7.4e-15

AA Sequence

MSAQTSPAEKGLNPGLMCQESYACSGTDEAIFECDECCSLQCLRCEEELHRQERLRNHERIRLKPGHVPY      1 - 70
CDLCKGLSGHLPGVRQRAIVRCQTCKINLCLECQKRTHSGGNKRRHPVTVYNVSNLQESLEAEEMDEETK     71 - 140
RKKMTEKVVSFLLVDENEEIQVTNEEDFIRKLDCKPDQHLKVVSIFGNTGDGKSHTLNHTFFYGREVFKT    141 - 210
SPTQESCTVGVWAAYDPVHKVAVIDTEGLLGATVNLSQRTRLLLKVLAISDLVIYRTHADRLHNDLFKFL    211 - 280
GDASEAYLKHFTKELKATTARCGLDVPLSTLGPAVIIFHETVHTQLLGSDHPSEVPEKLIQDRFRKLGRF    281 - 350
PEAFSSIHYKGTRTYNPPTDFSGLRRALEQLLENNTTRSPRHPGVIFKALKALSDRFSGEIPDDQMAHSS    351 - 420
FFPDEYFTCSSLCLSCGVGCKKSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSA    421 - 490
STDSPWMGLAKYAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVRTEIVHVWPGTDGFLKDNNNAAQRL    491 - 560
LDGMNFMAQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNKCATSFKDNDTKHHCRACGEGFCDS    561 - 630
CSSKTRPVPERGWGPAPVRVCDNCYEARNVQLAVTEAQVDDEGGTLIARKVGEAVQNTLGAVVTAIDIPL    631 - 700
GLVKDAARPAYWVPDHEILHCHNCRKEFSIKLSKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNC    701 - 770
NKKPGDL                                                                   771 - 777
//

Text Mined References (17)

PMID Year Title
25578879 2015 PI(5)P regulates autophagosome biogenesis.
23455425 2013 Autophagosomes form at ER-mitochondria contact sites.
22456507 2012 Dynamic and transient interactions of Atg9 with autophagosomes, but not membrane integration, are required for autophagy.
22178386 2012 TRIM13 regulates ER stress induced autophagy and clonogenic ability of the cells.
19898463 2009 A subdomain of the endoplasmic reticulum forms a cradle for autophagosome formation.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11804589 2002 Identification of ARAP3, a novel PI3K effector regulating both Arf and Rho GTPases, by selective capture on phosphoinositide affinity matrices.
11739631 2001 FENS-1 and DFCP1 are FYVE domain-containing proteins with distinct functions in the endosomal and Golgi compartments.
11256955 2001 Characterization of a novel phosphatidylinositol 3-phosphate-binding protein containing two FYVE fingers in tandem that is targeted to the Golgi.
11024279 2000 Double FYVE-containing protein 1 (DFCP1): isolation, cloning and characterization of a novel FYVE finger protein from a human bone marrow cDNA library.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.