Property Summary

NCBI Gene PubMed Count 52
PubMed Score 79.52
PubTator Score 64.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 4.1e-02
ductal carcinoma in situ 1.100 2.7e-02
head and neck cancer and chronic obstruc... 1.100 4.5e-03
interstitial cystitis 2.100 6.1e-04
invasive ductal carcinoma 1.200 1.1e-02
lung adenocarcinoma 1.100 5.2e-05
malignant mesothelioma 1.200 3.2e-04
osteosarcoma -2.142 6.9e-06
primary Sjogren syndrome 1.200 5.6e-03
psoriasis 1.200 3.5e-03
tuberculosis -2.000 2.0e-08
ulcerative colitis 1.100 9.4e-03

Protein-protein Interaction (1)

Gene RIF (45)

AA Sequence

MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRS      1 - 70
AHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRS     71 - 140
DYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSY    141 - 210
QGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPL    211 - 280
YKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPS    281 - 350
FWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLD    351 - 420
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTF    421 - 490
DSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS                          491 - 538
//

Text Mined References (54)

PMID Year Title