Property Summary

NCBI Gene PubMed Count 50
Grant Count 29
R01 Count 9
Funding $2,919,993.35
PubMed Score 75.97
PubTator Score 64.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
cutaneous lupus erythematosus 1.200 0.041
psoriasis 2.100 0.000
osteosarcoma -2.142 0.000
tuberculosis -2.100 0.000
interstitial cystitis 2.100 0.001
primary Sjogren syndrome 1.200 0.006
lung adenocarcinoma 1.100 0.000
ductal carcinoma in situ 1.100 0.027
invasive ductal carcinoma 1.700 0.001
ulcerative colitis 1.100 0.009
head and neck cancer and chronic obstruc... 1.100 0.004

Gene RIF (43)

PMID Text
25941256 STAT3 signaling downstream of IL-23R and IL-21R has a role in controlling human mucosal-associated invariant T cells and NKT cell numbers
25647271 expression of IL-21 and IL-21R were up-regulated in autoimmune thyroid disease and may be involved in the pathogenesis of the disease through augmenting aberrant immune cascade
25500255 IL-21/IL-21R could act as potential biomarkers presenting early systemic sclerosis skin lesions severity.
25398835 interleukin-21 receptor deficiency is associated with Severe Combined Immunodeficiency.
25007029 IL-21R on B cells is upregulated in allergic rhinitis patients when compared to controls. IL-21/IL-21R may be involved in the regulation of allergic reactions through the inhibition of IgE.
24728504 Human neutrophils in peripheral blood express functional IL-21 receptors.
23830147 The IL-21R/STAT3 pathway is required for many aspects of human CD8(+) T-cell behavior but in some cases can be compensated by other signals.
23440042 human IL-21R deficiency causes an immunodeficiency and highlights the need for early diagnosis
23396946 Human monocyte-like THP-1 cells express two IL-21 receptor components, CD132 (gammac) and IL-21Ralpha, on their cell surface, as assessed by flow cytometry.
23354321 Data suggest that IL21 rs2221903 and IL21R rs3093301 polymorphisms may, independently or interactively, affect the susceptibility to and/or persistence of HBV infection potentially through altering IL-21 and IgE production.
More...

AA Sequence

MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRS      1 - 70
AHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRS     71 - 140
DYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSY    141 - 210
QGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPL    211 - 280
YKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPS    281 - 350
FWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLD    351 - 420
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTF    421 - 490
DSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS                          491 - 538
//

Text Mined References (52)

PMID Year Title
25941256 2015 STAT3 is a critical cell-intrinsic regulator of human unconventional T cell numbers and function.
25647271 2015 Increased IL-21/IL-21R expression and its proinflammatory effects in autoimmune thyroid disease.
25500255 2015 The elevated expression of Th17-related cytokines and receptors is associated with skin lesion severity in early systemic sclerosis.
25398835 2015 Extending the clinical and immunological phenotype of human interleukin-21 receptor deficiency.
25007029 2015 Upregulated interleukin-21 receptor on B cells associated with the downregulation of IgE in patients with allergic rhinitis.
24728504 2014 Human peripheral neutrophils express functional IL-21 receptors.
23830147 2013 Signal transducer and activator of transcription 3 (STAT3) mutations underlying autosomal dominant hyper-IgE syndrome impair human CD8(+) T-cell memory formation and function.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23440042 2013 Loss-of-function mutations in the IL-21 receptor gene cause a primary immunodeficiency syndrome.
23396946 2013 IL-21 enhances phagocytosis in mononuclear phagocyte cells: identification of spleen tyrosine kinase as a novel molecular target of IL-21.
More...