Property Summary

NCBI Gene PubMed Count 323
PubMed Score 349.47
PubTator Score 531.07

Knowledge Summary

Patent

No data available

Protein-protein Interaction (1)

Gene RIF (303)

AA Sequence

MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFS      1 - 70
CFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKM     71 - 140
IHQHLSSRTHGSEDS                                                           141 - 155
//

Text Mined References (324)

PMID Year Title