Property Summary

NCBI Gene PubMed Count 294
Grant Count 333
R01 Count 104
Funding $44,988,026.15
PubMed Score 328.07
PubTator Score 531.07

Knowledge Summary

Patent

No data available

Synonym

Accession Q9HBE4 A5J0L4 IL-21
Symbols Za11
IL-21
CVID11

Gene

PDB

2OQP   3TGX  

Gene RIF (275)

PMID Text
26818544 HCV infection increased the frequency of CD4+CXCR5+ T cells and decreased the frequency of CD27+IgG+ B cells. CD4+CXCR5+ T cells activated CD27+IgG+ B cells via the secretion of IL-21.
26802931 IL-21 expression is promoted by MEKK4 in malignant T cells and is associated with progression risk in cutaneous T-cell lymphoma
26742440 IL-21 protein was higher in serum and mRNA and protein were higher in disc tissue of patients with lumbar disc herniation compared to controls.
26646950 The results suggest that IL-21 promotes migration and invasion of Rheumatoid arthritis-Fibroblast-like synoviocytes. Therefore, therapeutic strategies targeting IL-21 might be effective for the treatment of Rheumatoid arthritis.
26646149 all Ifng+ T cells produced IL-21, but only a small percentage of highly proliferative Ifng+ T cells maintained a T-bethi phenotype
26566861 IL-12 induced the generation of IL-21- and IFN-gamma-co-expressing poly-functional CD4+ T cells from human naive CD4+ T cells.
26535636 the minor allele T of both rs6822844 (T vs G, OR = 0.72, 95%CI = 0.67-0.78, P < 0.001) and rs6840978 (T vs C, OR = 0.76, 95%CI = 0.71-0.83, P < 0.001) in IL21 significantly decreased the risk of celiac disease (Meta-Analysis)
26482544 results suggest that IL-21 could promote rheumatoid arthritis fibroblast-like synoviocytes proliferation and production of proinflammatory cytokines
26466984 IL-21 exerts major effects on B-cell activation and differentiation or apoptosis during humoral immune responses, and also affects different subtypes of T cells. (Review)
26416419 CD3(+)TCRvbeta11(+) NKT cells from a local site of M. tuberculosis infection produce IL-21, express CXCR5 and CD40L, help B cells to secrete IgG and IgA, and may participate in local immune responses against M. tuberculosis infection.
More...

AA Sequence

MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFS      1 - 70
CFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKM     71 - 140
IHQHLSSRTHGSEDS                                                           141 - 155
//

Text Mined References (295)

PMID Year Title
26818544 2016 CD4+CXCR5+ T cells activate CD27+IgG+ B cells via IL-21 in patients with hepatitis C virus infection.
26802931 2016 The Expression of IL-21 Is Promoted by MEKK4 in Malignant T Cells and Associated with Increased Progression Risk in Cutaneous T-Cell Lymphoma.
26742440 2015 Interleukin-21 Is Associated with the Pathogenesis of Lumbar Disc Herniation.
26646950 2016 Interleukin-21 induces migration and invasion of fibroblast-like synoviocytes from patients with rheumatoid arthritis.
26646149 2015 IFN-? and IL-21 Double Producing T Cells Are Bcl6-Independent and Survive into the Memory Phase in Plasmodium chabaudi Infection.
26566861 2015 IL-12 induced the generation of IL-21- and IFN-?-co-expressing poly-functional CD4+ T cells from human naive CD4+ T cells.
26535636 2015 Association between IL2/IL21 and SH2B3 polymorphisms and risk of celiac disease: a meta-analysis.
26482544 2016 Interleukin-21 Induces Proliferation and Proinflammatory Cytokine Profile of Fibroblast-like Synoviocytes of Patients with Rheumatoid Arthritis.
26466984 2016 Biological effects of IL-21 on different immune cells and its role in autoimmune diseases.
26416419 2015 Antigen-specific human NKT cells from tuberculosis patients produce IL-21 to help B cells for the production of immunoglobulins.
More...