Property Summary

NCBI Gene PubMed Count 24
PubMed Score 95.11
PubTator Score 31.11

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.100 3.3e-02
atypical teratoid / rhabdoid tumor 1.200 5.2e-04
ependymoma 1.100 2.1e-05
glioblastoma 1.100 1.7e-02
group 3 medulloblastoma 1.700 1.5e-04
lung cancer 1.600 2.5e-04
medulloblastoma, large-cell 1.200 1.7e-04
oligodendroglioma 1.100 9.8e-03
osteosarcoma -1.334 1.1e-03
primitive neuroectodermal tumor 1.200 3.8e-03
psoriasis -1.100 8.0e-10

Gene RIF (13)

AA Sequence

MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLAACSEYFESVF      1 - 70
SAQLGDGGAADGGPADVGGATAAPGGGAGGSRELEMHTISSKVFGDILDFAYTSRIVVRLESFPELMTAA     71 - 140
KFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGTSDLGFPLDMTNGAALAANSNGIAGSMQPEE    141 - 210
EAARAAGAAIAGQASLPVLPGVDRLPMVAGPLSPQLLTSPFPSVASSAPPLTGKRGRGRPRKANLLDSMF    211 - 280
GSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSR    281 - 350
TRKQVACEICGKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK    351 - 420
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAAYMADHLKKHS    421 - 490
EGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPILNGGAAFHCARTYGNKEGQKCSHQDPIE    491 - 560
SSDSYGDLSDASDLKTPEKQSANGSFSCDMAVPKNKMESDGEKKYPCPECGSFFRSKSYLNKHIQKVHVR    561 - 630
ALGGPLGDLGPALGSPFSPQQNMSLLESFGFQIVQSAFASSLVDPEVDQQPMGPEGK                 631 - 687
//

Text Mined References (27)

PMID Year Title