Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.08
PubTator Score 3.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.48493280087944E-10
juvenile dermatomyositis 1189 1.86257505999772E-8
atypical teratoid / rhabdoid tumor 4369 5.3822008272138E-8
Pick disease 1893 1.38632189295229E-6
glioblastoma 5572 2.20642087790694E-6
medulloblastoma, large-cell 6234 4.14145013042178E-6
tuberculosis and treatment for 6 months 686 4.22958940552763E-6
ovarian cancer 8492 1.15793613687005E-5
pediatric high grade glioma 2712 1.31325210514362E-4
psoriasis 6685 1.46631765328077E-4
hepatocellular carcinoma 550 2.51708443296395E-4
primitive neuroectodermal tumor 3031 0.00105110826877979
group 4 medulloblastoma 1875 0.00288212197790095
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00464745474367099
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00545910285115091
lung cancer 4473 0.00547901010591115
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00898832668193426
pancreatic cancer 2300 0.0126067154328325
primary pancreatic ductal adenocarcinoma 1271 0.0165145616260491
spina bifida 1064 0.0331994072194255
subependymal giant cell astrocytoma 2287 0.0493279319534227

Expression

Synonym

Accession Q9HBD1 Q4VXB1 Q5JPD7 Q86ST6 Q8N3D6 Q96F27 Q9H5J2 Q9HBD2 Q9NWN9 Q9NXE1
Symbols MNAB
RNF164

Gene

PDB

4Z30   4Z31   4ZLC   4ZLD  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid

Gene RIF (2)

PMID Text
26489670 Crystal structures, small-angle X-ray scattering, and E2 profiling revealed that while the two paralogs are highly homologous, RC3H2 and RC3H1 are different in their structures and functions.
26249698 Roquin-1 and roquin-2 proteins function redundantly in mRNA degradation.

AA Sequence

MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAINTDIDVLPVNFAL      1 - 70
LQLVGAQVPDHQSIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGVASLNQSALSRPMQRKLVTLVNC     71 - 140
QLVEEEGRVRAMRAARSLGERTVTELILQHQNPQQLSANLWAAVRARGCQFLGPAMQEEALKLVLLALED    141 - 210
GSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRSYEALRREH    211 - 280
DAQIVHIAMEAGLRISPEQWSSLLYGDLAHKSHMQSIIDKLQSPESFAKSVQELTIVLQRTGDPANLNRL    281 - 350
RPHLELLANIDPNPDAVSPTWEQLENAMVAVKTVVHGLVDFIQNYSRKGHETPQPQPNSKYKTSMCRDLR    351 - 420
QQGGCPRGTNCTFAHSQEELEKYRLRNKKINATVRTFPLLNKVGVNNTVTTTAGNVISVIGSTETTGKIV    421 - 490
PSTNGISNAENSVSQLISRSTDSTLRALETVKKVGKVGANGQNAAGPSADSVTENKIGSPPKTPVSNVAA    491 - 560
TSAGPSNVGTELNSVPQKSSPFLTRVPVYPPHSENIQYFQDPRTQIPFEVPQYPQTGYYPPPPTVPAGVA    561 - 630
PCVPRFVRSNNVPESSLPPASMPYADHYSTFSPRDRMNSSPYQPPPPQPYGPVPPVPSGMYAPVYDSRRI    631 - 700
WRPPMYQRDDIIRSNSLPPMDVMHSSVYQTSLRERYNSLDGYYSVACQPPSEPRTTVPLPREPCGHLKTS    701 - 770
CEEQIRRKPDQWAQYHTQKAPLVSSTLPVATQSPTPPSPLFSVDFRADFSESVSGTKFEEDHLSHYSPWS    771 - 840
CGTIGSCINAIDSEPKDVIANSNAVLMDLDSGDVKRRVHLFETQRRTKEEDPIIPFSDGPIISKWGAISR    841 - 910
SSRTGYHTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYGNEATSSAHYVERDRFIVTDLSGHRK    911 - 980
HSSTGDLLSLELQQAKSNSLLLQREANALAMQQKWNSLDEGRHLTLNLLSKEIELRNGELQSDYTEDATD    981 - 1050
TKPDRDIELELSALDTDEPDGQSEPIEEILDIQLGISSQNDQLLNGMAVENGHPVQQHQKEPPKQKKQSL   1051 - 1120
GEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMVN   1121 - 1190
S//

Text Mined References (17)

PMID Year Title
26489670 2015 New Insights into the RNA-Binding and E3 Ubiquitin Ligase Activities of Roquins.
26249698 2015 Structure of human Roquin-2 and its complex with constitutive-decay element RNA.
24448648 2014 Roquin-2 promotes ubiquitin-mediated degradation of ASK1 to regulate stress responses.
23550652 2013 Molecular control of Tfh-cell differentiation by Roquin family proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20412057 2010 The ROQUIN family of proteins localizes to stress granules via the ROQ domain and binds target mRNAs.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...