Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $72,950
PubMed Score 4.08
PubTator Score 3.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9HBD1 Q4VXB1 Q5JPD7 Q86ST6 Q8N3D6 Q96F27 Q9H5J2 Q9HBD2 Q9NWN9 Q9NXE1
Symbols MNAB
RNF164

Gene

 Grant Application (1)

PDB

4Z30   4Z31   4ZLC   4ZLD  

Gene RIF (2)

PMID Text
26489670 Crystal structures, small-angle X-ray scattering, and E2 profiling revealed that while the two paralogs are highly homologous, RC3H2 and RC3H1 are different in their structures and functions.
26249698 Roquin-1 and roquin-2 proteins function redundantly in mRNA degradation.

AA Sequence

MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAINTDIDVLPVNFAL      1 - 70
LQLVGAQVPDHQSIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGVASLNQSALSRPMQRKLVTLVNC     71 - 140
QLVEEEGRVRAMRAARSLGERTVTELILQHQNPQQLSANLWAAVRARGCQFLGPAMQEEALKLVLLALED    141 - 210
GSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRSYEALRREH    211 - 280
DAQIVHIAMEAGLRISPEQWSSLLYGDLAHKSHMQSIIDKLQSPESFAKSVQELTIVLQRTGDPANLNRL    281 - 350
RPHLELLANIDPNPDAVSPTWEQLENAMVAVKTVVHGLVDFIQNYSRKGHETPQPQPNSKYKTSMCRDLR    351 - 420
QQGGCPRGTNCTFAHSQEELEKYRLRNKKINATVRTFPLLNKVGVNNTVTTTAGNVISVIGSTETTGKIV    421 - 490
PSTNGISNAENSVSQLISRSTDSTLRALETVKKVGKVGANGQNAAGPSADSVTENKIGSPPKTPVSNVAA    491 - 560
TSAGPSNVGTELNSVPQKSSPFLTRVPVYPPHSENIQYFQDPRTQIPFEVPQYPQTGYYPPPPTVPAGVA    561 - 630
PCVPRFVRSNNVPESSLPPASMPYADHYSTFSPRDRMNSSPYQPPPPQPYGPVPPVPSGMYAPVYDSRRI    631 - 700
WRPPMYQRDDIIRSNSLPPMDVMHSSVYQTSLRERYNSLDGYYSVACQPPSEPRTTVPLPREPCGHLKTS    701 - 770
CEEQIRRKPDQWAQYHTQKAPLVSSTLPVATQSPTPPSPLFSVDFRADFSESVSGTKFEEDHLSHYSPWS    771 - 840
CGTIGSCINAIDSEPKDVIANSNAVLMDLDSGDVKRRVHLFETQRRTKEEDPIIPFSDGPIISKWGAISR    841 - 910
SSRTGYHTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYGNEATSSAHYVERDRFIVTDLSGHRK    911 - 980
HSSTGDLLSLELQQAKSNSLLLQREANALAMQQKWNSLDEGRHLTLNLLSKEIELRNGELQSDYTEDATD    981 - 1050
TKPDRDIELELSALDTDEPDGQSEPIEEILDIQLGISSQNDQLLNGMAVENGHPVQQHQKEPPKQKKQSL   1051 - 1120
GEDHVILEEQKTILPVTSCFSQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMVN   1121 - 1190
S//

Text Mined References (17)

PMID Year Title
26489670 2015 New Insights into the RNA-Binding and E3 Ubiquitin Ligase Activities of Roquins.
26249698 2015 Structure of human Roquin-2 and its complex with constitutive-decay element RNA.
24448648 2014 Roquin-2 promotes ubiquitin-mediated degradation of ASK1 to regulate stress responses.
23550652 2013 Molecular control of Tfh-cell differentiation by Roquin family proteins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20412057 2010 The ROQUIN family of proteins localizes to stress granules via the ROQ domain and binds target mRNAs.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...