Property Summary

NCBI Gene PubMed Count 7
Grant Count 484
R01 Count 156
Funding $136,047,040.29
PubMed Score 1856.31
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Synonym

Accession Q9HBA9 NAALADase
Symbols PSM
GCP3
FOLH2
FOLHP
PSMAL
GCPIII
PSMA-LIKE

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
19678840 comparison of X-ray crystallography GCPIII structures with the equivalent GCPII complexes reveals differences in the organization of specificity pockets, in surface charge distribution, and in the occupancy of the co-catalytic zinc sites
19243386 GCP3-expressing gastic carcinoma: a distinct subgroup unifying hepatoid, clear-cell, and alpha-fetoprotein-producing gastric carcinomas.

AA Sequence

MGGSAPPDSSWRGSLKVSYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHR      1 - 70
DSWVFGGIDPQSGAAVVHETVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEDNSRLLQERGVA     71 - 140
YINADSSIEGNYTLRVDCTPLMYSLVYNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSG    141 - 210
NDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELA    211 - 280
NSIVLPFDCRDYAVVLRKYADKIYNISMKHPQEMKTYSLSFDSLFSAVKNFTEIASKFSERLQDFDKSNP    281 - 350
ILLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGDV    351 - 420
KRQISVAAFTVQAAAETLSEVA                                                    421 - 442
//

Text Mined References (7)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
17241121 2007 Biochemical characterization of human glutamate carboxypeptidase III.
17160644 2007 Molecular evolution of the transferrin receptor/glutamate carboxypeptidase II family.
14716746 2004 Comparative analysis of prostate-specific membrane antigen (PSMA) versus a prostate-specific membrane antigen-like gene.
9838072 1998 Mapping, genomic organization and promoter analysis of the human prostate-specific membrane antigen gene.
9691167 1998 Detailed genetic mapping around a putative prostate-specific membrane antigen locus on human chromosome 11p11.2.
8417812 1993 Molecular cloning of a complementary DNA encoding a prostate-specific membrane antigen.