Property Summary

NCBI Gene PubMed Count 154
PubMed Score 670.09
PubTator Score 339.81

Knowledge Summary

Patent (81,382)


  Disease Sources (6)

Disease Target Count Z-score Confidence
Neuropathy 210 4.189 2.1
Neurodegenerative disease 383 0.0 4.0



Accession Q9HBA0 B7ZKQ6 Q17R79 Q2Y122 Q2Y123 Q2Y124 Q86YZ6 Q8NDY7 Q8NG64 Q96Q92 Q96RS7 Q9HBC0 TrpV4
Symbols SMAL


PANTHER Protein Class (2)


4DX1   4DX2  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (135)

26475857 P2Y1 couples to and activates TRPV4. PKC inhibitors prevented P2Y1 receptor activation of TRPV4.
26358221 The inflammatory cytokine TNF-a can modulate the activity of the mechanosensitive ion channels TRPA1 and TRPV4 in odontoblasts via the p38 MAPK pathway but has differential effects on their expression.
26330151 the activation of myenteric TRPV4 and the subsequent production of NO by these neurons have the potential to become an important target for the pharmacological treatment of GI disorders with predominant hypermotility symptoms.
26294342 Role of endothelial TRPV4 channels in vascular actions of the endocannabinoid, 2-arachidonoylglycerol
26289129 Calcium sensitive TRPV4 translocation is associated with the regulation of endothelial response to mechanical stimulation.
26259779 these data strongly suggest endogenous TRPV4 channels as a mechanosensor, mediating cyclic stretch-induced realignment of hESC-CMs.
26249260 A mutation in TRPV4 results in altered chondrocyte calcium signaling in severe metatropic dysplasia.
26222277 Identify TRPV4 as novel regulator of neutrophil activation and suggest contributions of both parenchymal and neutrophilic TRPV4 in the pathophysiology of acute lung injury.
26170305 TrpV4 mutations cause skeletal dysplasia by constitutive leakage
26146187 Interaction between the linker, pre-S1, and TRP domains determines folding, assembly, and trafficking of TRPV1 and TRPV4 channels.

AA Sequence

VVVPLDSMGNPRCDGHQQGYPRKWRTDDAPL                                           841 - 871

Text Mined References (155)

PMID Year Title
26475857 2015 P2Y1 Receptor Activation of the TRPV4 Ion Channel Enhances Purinergic Signaling in Satellite Glial Cells.
26358221 2015 TNF-?-induced p38MAPK activation regulates TRPA1 and TRPV4 activity in odontoblast-like cells.
26330151 2015 Transient receptor potential vanilloid 4 inhibits mouse colonic motility by activating NO-dependent enteric neurotransmission.
26294342 2015 Role of endothelial TRPV4 channels in vascular actions of the endocannabinoid, 2-arachidonoylglycerol.
26289129 2016 Shear stress mediates exocytosis of functional TRPV4 channels in endothelial cells.
26259779 2015 Uniaxial cyclic stretch stimulates TRPV4 to induce realignment of human embryonic stem cell-derived cardiomyocytes.
26249260 2015 A mutation in TRPV4 results in altered chondrocyte calcium signaling in severe metatropic dysplasia.
26222277 2016 Role of Transient Receptor Potential Vanilloid 4 in Neutrophil Activation and Acute Lung Injury.
26170305 2015 A channelopathy mechanism revealed by direct calmodulin activation of TrpV4.
26146187 2015 Interaction between the Linker, Pre-S1, and TRP Domains Determines Folding, Assembly, and Trafficking of TRPV Channels.