Property Summary

NCBI Gene PubMed Count 23
Grant Count 4
R01 Count 1
Funding $69,510.95
PubMed Score 29.07
PubTator Score 6.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.150 0.000

Synonym

Accession Q9HB90 Q9H202 Q9H8Q8 Rag C
Symbols GTR2
RAGC
TIB929

Gene

PDB

3LLU  

Gene RIF (2)

PMID Text
26691987 activating nature of the RRAGC mutations, their existence in the dominant clone and their stability during disease progression support their potential as an excellent candidate for therapeutic targeting
24095279 FLCN and its binding partners, FNIP1/2, are Rag-interacting proteins with GAP activity for RagC/D, but not RagA/B.

AA Sequence

MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSSKPRILLMGLR      1 - 70
RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGAL     71 - 140
IYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEK    141 - 210
LHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQ    211 - 280
SYELCCDMIDVVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKG    281 - 350
LIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI                         351 - 399
//

Text Mined References (29)

PMID Year Title
27234373 2016 De novo RRAGC mutation activates mTORC1 signaling in syndromic fetal dilated cardiomyopathy.
27222292 2016 Identification of variants in MBNL1 in patients with a myotonic dystrophy-like phenotype.
26691987 2016 Recurrent mTORC1-activating RRAGC mutations in follicular lymphoma.
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25446900 2014 Rab1A is an mTORC1 activator and a colorectal oncogene.
25259925 2014 Sestrins function as guanine nucleotide dissociation inhibitors for Rag GTPases to control mTORC1 signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24095279 2013 The folliculin tumor suppressor is a GAP for the RagC/D GTPases that signal amino acid levels to mTORC1.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
More...