Property Summary

NCBI Gene PubMed Count 28
PubMed Score 30.65
PubTator Score 6.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Lymphoma, Follicular 18 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.1e-04
Disease Target Count Z-score Confidence
follicular lymphoma 20 3.376 1.7
Birt-Hogg-Dube syndrome 11 3.228 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.150 3.1e-04

Gene RIF (6)

AA Sequence

MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSSKPRILLMGLR      1 - 70
RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGAL     71 - 140
IYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEK    141 - 210
LHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQ    211 - 280
SYELCCDMIDVVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKG    281 - 350
LIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI                         351 - 399
//

Text Mined References (32)

PMID Year Title