Property Summary

NCBI Gene PubMed Count 12
Grant Count 11
Funding $974,228.26
PubMed Score 89.25
PubTator Score 49.63

Knowledge Summary

Patent (6,744)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma -1.800 0.001
adult high grade glioma -1.300 0.001

AA Sequence

MTPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMPICATYLLI      1 - 70
FVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYEMWHNYPFLLGVGGCYFRTLL     71 - 140
FEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIRQLHVPCR    141 - 210
GPVPDSAVCMLVRPRALYNMVVQTTALLFFCLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSR    211 - 280
YTCRLQQHDRGRRQVTKMLFVLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSA    281 - 350
ANPVLYSLMSSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQ    351 - 420
QETDPS                                                                    421 - 426
//

Text Mined References (12)

PMID Year Title
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15635449 2005 Identification of neuromedin S and its possible role in the mammalian circadian oscillator system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10899166 2000 Identification and characterization of two neuromedin U receptors differentially expressed in peripheral tissues and the central nervous system.
10811630 2000 Neuromedin U is a potent agonist at the orphan G protein-coupled receptor FM3.
More...