Property Summary

Ligand Count 6
NCBI Gene PubMed Count 14
PubMed Score 96.98
PubTator Score 49.63

Knowledge Summary

Patent (6,744)

TINX Plot

  Disease (4)

Disease Target Count P-value
adult high grade glioma 3801 5.3e-04
breast carcinoma 1638 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Disease Target Count Z-score Confidence
Obesity 678 3.038 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.300 5.3e-04
breast carcinoma -1.800 1.2e-03

 CSPA Cell Line (2)

Protein-protein Interaction (1)

AA Sequence

MTPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMPICATYLLI      1 - 70
FVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYEMWHNYPFLLGVGGCYFRTLL     71 - 140
FEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIRQLHVPCR    141 - 210
GPVPDSAVCMLVRPRALYNMVVQTTALLFFCLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSR    211 - 280
YTCRLQQHDRGRRQVTKMLFVLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSA    281 - 350
ANPVLYSLMSSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQ    351 - 420
QETDPS                                                                    421 - 426
//

Text Mined References (14)

PMID Year Title