Property Summary

NCBI Gene PubMed Count 28
Grant Count 24
R01 Count 15
Funding $2,170,413.24
PubMed Score 92.01
PubTator Score 31.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.759 0.000
primary pancreatic ductal adenocarcinoma -1.087 0.033
group 3 medulloblastoma 1.300 0.009
pancreatic cancer -1.200 0.045

 GO Function (1)

Gene RIF (15)

PMID Text
25936804 By sequestering PIDD at the kinetochore, BubR1 acts to delay PIDDosome formation until the next cycle, defining a new mechanism by which cells evade apoptosis during mitosis.
22854598 The ATM phosphorylation of the PIDD DD enables a binary switch through which cells elect to survive or die upon DNA injury.
21415862 PIDD performs key functions upon UV irradiation, including TLS, NHEJ, NF-kappaB activation and cell death.
21371439 a new splicing variant of PIDD named PIDD4 is reported.
20966961 Hsp90 has a major role in controlling PIDD functional activity.
20406701 point mutations on RAIDD (R147E) and on PIDD (Y814A) exert a dominant negative effect on the formation of the PIDDosome, and that this effect cannot be applied after the PIDDosome has been formed
20208132 Total caspase-2 is upregulated during tumour progression in renal cell carcinomas.
18238895 p53-mediated apoptosis occurs by a PIDD- and caspase 2-dependent mechanism, and p53's full transcriptional regulatory functions may be required only for events that are downstream of cytochrome c release
17637755 PIDD isoforms are capable of activating nuclear factor-kappaB in response to genotoxic stress, but only isoform 1 interacts with RIP-associated ICH-1/CED-3 homologous protein with a death domain and activates caspase-2.
17437012 No correlation between Pidd expression and the p53 mutation status of oral squamous cell carcinoma, suggesting that Pidd expression may be regulated by p53-independent mechanisms.
More...

AA Sequence

MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLS      1 - 70
THEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAGLSGLAHLAHLDLSFNSLETL     71 - 140
PACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLPPALGALSTLQRLDLSQNLLDTLP    141 - 210
PEIGGLGSLLELNLASNRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPP    211 - 280
ELLDAPFVRLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLACGVRLQFPAGAT    281 - 350
ATPITIRYRLLLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVVRTRNDNS    351 - 420
WGDLETYLEEEAPQRLWAHCQVPHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVIFPPGATEEPRR    421 - 490
VSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSGPPSFLQPVTVQLPLPSGITGLSLDRSRLHLLYWAPP    491 - 560
AATWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNCVGGLARKAWERLRLHRVNLIALQRRRDPEQV    561 - 630
LLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKN    631 - 700
VKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGA    701 - 770
GLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWA    771 - 840
ERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLAPKDPALPGSSAPQPPEPAQA    841 - 910
//

Text Mined References (29)

PMID Year Title
25936804 2015 An Inhibitor of PIDDosome Formation.
22854598 2012 PIDD death-domain phosphorylation by ATM controls prodeath versus prosurvival PIDDosome signaling.
21726810 2011 Caspase-2-mediated cleavage of Mdm2 creates a p53-induced positive feedback loop.
21415862 2011 PIDD orchestrates translesion DNA synthesis in response to UV irradiation.
21371439 2011 PIDD4, a novel PIDD isoform without the LRR domain, can independently induce cell apoptosis in cytoplasm.
20966961 2011 Regulation of PIDD auto-proteolysis and activity by the molecular chaperone Hsp90.
20935634 2010 The Fas-FADD death domain complex structure reveals the basis of DISC assembly and disease mutations.
20406701 2010 Identification and analysis of dominant negative mutants of RAIDD and PIDD.
20395368 2010 Chronic cisplatin treatment promotes enhanced damage repair and tumor progression in a mouse model of lung cancer.
20208132 2010 PIDDosome expression and the role of caspase-2 activation for chemotherapy-induced apoptosis in RCCs.
More...