Property Summary

NCBI Gene PubMed Count 32
Grant Count 7
R01 Count 4
Funding $622,109.34
PubMed Score 50.00
PubTator Score 38.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.160 0.021
astrocytic glioma -1.400 0.020
ependymoma -1.700 0.035
psoriasis -1.200 0.000
osteosarcoma -2.492 0.000
glioblastoma -1.300 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.002
lung cancer 1.600 0.001
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.086 0.026
Breast cancer 1.200 0.000

Gene RIF (22)

PMID Text
26825673 CacyBP/SIP plays an important role in inhibiting apoptosis of glioma cells which might be mediated by ERK1/2 signaling pathway.
26603518 CacyBP/SIP is a useful indicator of dis processes in Chronic Lymphocytic Leukemia (CLL) and plays an important role in sustaining the balance of cell proliferation and apoptosis.
25110433 CacyBP/SIP nuclear translocation promotes the proliferation and cell cycle progression of gastric cancer cells.
24740456 Overexpression of CacyBP is associated with glioma.
23543800 This study presents CacyBP as a promising candidate biomarker for colorectal cancer (CRC) metastasis and also sheds light on the underlying molecular mechanism by which CacyBP promotes CRC metastasis.
23463283 CacyBP enhances multidrug resistance of pancreatic cancer cells by regulation of P-gp and Bcl-2.
23166591 Expression of HIV-1 Tat upregulates the abundance of calcyclin binding protein (CACYBP) in the nucleoli of Jurkat T-cells
22874833 These findings reveal a novel function for SNRK in the regulation of colon cancer cell proliferation and beta-catenin signaling.
22480271 different activity of CacyBP/SIP in neuroblastoma NB2a and colon cancer HCT116 cells might affect the ERK1/2 pathway in the differentiation or proliferation processes
22295074 new insight into the interaction between S100 proteins and CacyBP/SIP
More...

AA Sequence

MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITTG      1 - 70
YTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVEG     71 - 140
SSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTI    141 - 210
NKAWVESREKQAKGDTEF                                                        211 - 228
//

Text Mined References (41)

PMID Year Title
26825673 2016 CacyBP/SIP inhibits Doxourbicin-induced apoptosis of glioma cells due to activation of ERK1/2.
26603518 2016 Expression and regulation of CacyBP/SIP in chronic lymphocytic leukemia cell balances of cell proliferation with apoptosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25110433 2014 CacyBP/SIP nuclear translocation induced by gastrin promotes gastric cancer cell proliferation.
24740456 2014 CacyBP/SIP protein is important for the proliferation of human glioma cells.
23543800 2013 iTRAQ based quantitative proteomics approach validated the role of calcyclin binding protein (CacyBP) in promoting colorectal cancer metastasis.
23463283 2013 CacyBP/SIP enhances multidrug resistance of pancreatic cancer cells by regulation of P-gp and Bcl-2.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22874833 2012 Snf1-related kinase inhibits colon cancer cell proliferation through calcyclin-binding protein-dependent reduction of ?-catenin.
More...