Tbio | RNA polymerase II elongation factor ELL3 |
Enhancer-binding elongation factor that specifically binds enhancers in embryonic stem cells (ES cells), marks them, and is required for their future activation during stem cell specification. Does not only bind to enhancer regions of active genes, but also marks the enhancers that are in a poised or inactive state in ES cells and is required for establishing proper RNA polymerase II occupancy at developmentally regulated genes in a cohesin-dependent manner. Probably required for priming developmentally regulated genes for later recruitment of the super elongation complex (SEC), for transcriptional activation during differentiation. Required for recruitment of P-TEFb within SEC during differentiation. Probably preloaded on germ cell chromatin, suggesting that it may prime gene activation by marking enhancers as early as in the germ cells. Promoting epithelial-mesenchymal transition (EMT) (By similarity). Elongation factor component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Component of the little elongation complex (LEC), a complex required to regulate small nuclear RNA (snRNA) gene transcription by RNA polymerase II and III (PubMed:22195968).
Comments
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | EggNOG Inparanoid |
Platypus | OMA EggNOG |
PMID | Text |
---|---|
26540344 | Ell3 stabilizes p53 following cisplatin treatment via its effects on ubiquitin-dependent and -independent proteasomal degradation pathways in breast cancer cells. |
23850691 | Ell3 may play a critical role in promoting oncogenesis in breast cancer by regulating cell proliferation and cancer stem cell properties via the ERK1/2 signaling pathway |
MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFS 1 - 70 FIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESW 71 - 140 QNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASR 141 - 210 KRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPS 211 - 280 PEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLED 281 - 350 KIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS 351 - 397 //
PMID | Year | Title |
---|---|---|
26540344 | 2015 | Ell3 stabilizes p53 following CDDP treatment via its effects on ubiquitin-dependent and -independent proteasomal degradation pathways in breast cancer cells. |
23850691 | 2013 | Ell3 stimulates proliferation, drug resistance, and cancer stem cell properties of breast cancer cells via a MEK/ERK-dependent signaling pathway. |
22895430 | 2012 | The super elongation complex (SEC) family in transcriptional control. |
22195968 | 2011 | The little elongation complex regulates small nuclear RNA transcription. |
21729782 | 2011 | Human mediator subunit MED26 functions as a docking site for transcription elongation factors. |
18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
16572171 | 2006 | Analysis of the DNA sequence and duplication history of human chromosome 15. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
More... |