Property Summary

NCBI Gene PubMed Count 10
Grant Count 7
R01 Count 7
Funding $288,146.05
PubMed Score 3.86
PubTator Score 4.50

Knowledge Summary

Patent

No data available

 GO Function (1)

Gene RIF (2)

PMID Text
26540344 Ell3 stabilizes p53 following cisplatin treatment via its effects on ubiquitin-dependent and -independent proteasomal degradation pathways in breast cancer cells.
23850691 Ell3 may play a critical role in promoting oncogenesis in breast cancer by regulating cell proliferation and cancer stem cell properties via the ERK1/2 signaling pathway

AA Sequence

MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFS      1 - 70
FIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESW     71 - 140
QNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASR    141 - 210
KRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPS    211 - 280
PEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLED    281 - 350
KIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS                           351 - 397
//

Text Mined References (12)

PMID Year Title
26540344 2015 Ell3 stabilizes p53 following CDDP treatment via its effects on ubiquitin-dependent and -independent proteasomal degradation pathways in breast cancer cells.
23850691 2013 Ell3 stimulates proliferation, drug resistance, and cancer stem cell properties of breast cancer cells via a MEK/ERK-dependent signaling pathway.
22895430 2012 The super elongation complex (SEC) family in transcriptional control.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...