Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.91
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

 GO Function (1)

Gene RIF (3)

AA Sequence

MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFS      1 - 70
FIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESW     71 - 140
QNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASR    141 - 210
KRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPS    211 - 280
PEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLED    281 - 350
KIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS                           351 - 397
//

Text Mined References (13)

PMID Year Title