Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.79
PubTator Score 28.32

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma -1.700 6.4e-03
cystic fibrosis -2.365 4.3e-07
medulloblastoma, large-cell -2.700 2.5e-04
non-small cell lung cancer -2.567 5.8e-19
lung adenocarcinoma -1.500 1.1e-13
acute myeloid leukemia -1.200 2.3e-02
psoriasis -1.500 9.4e-08
Endometriosis -1.055 3.0e-02
Breast cancer -3.000 4.6e-09
lung carcinoma -1.300 9.8e-13
spina bifida -1.847 3.2e-02
ovarian cancer -2.300 8.8e-04
pituitary cancer -1.400 2.2e-03

Gene RIF (20)

PMID Text
26394601 We found statistically significant association with AAO for three genes (WRN, NTN4 and LAMC3) with common associated variants.
26390805 inhibits placental microvascular endothelial cells proliferation, tube-like formation, migration and spheroid sprouting
25909166 Ntn4 promotes the proliferation and motility of gastric cancer cells which is mediated by its receptor Neo and through further activation of multi-oncogenic pathways
25288737 NTN4 acts as a positive regulator for TC axon branching through activity-dependent expression
24972566 Increased expression of miR-20a may play an important role in the pathogenesis of ovarian endometriosis by suppressing NTN4 expression.
24716747 Increased maternal netrin-4 levels in IUGR neonates may reflect in utero hypoxia, while the negative correlations between fetal netrin-1 and -4 levels may exert the dynamic balance between their angio- and anti-angiogenic properties.
24265816 NETRIN-4 protects glioblastoma cells FROM temozolomide induced senescence.
24120501 NTN4 expression was downregulated in cervical cancer tissues compared to normal controls, and in vivo mRNA level of NTN4 inversely correlated with miR-196a expression.
23921680 GWAS study found two new SNPs associated with nickel dermatitis; SNPs are located in the NTN4 and PELI1 genes
22705235 pattern of distribution suggests that a functional netrin-4-neogenin pathway might be restricted to syncytiotrophoblasts, mesenchymal cells, and villous endothelial cells
22496621 glioma cells reduce netrin-4 expression to decrease its inhibitory effects.
21799154 The alpha6beta1 integrin is a netrin-4 receptor in endothelial cells.
21406174 NT-4 overexpression decreases tumor growth and carcinomatosis, probably via an antiangiogenic effect
20730893 Netrin-4 is upregulated in breast carcinoma effusions compared to corresponding solid tumors
20407033 Netrin-4, at physiologic doses, induces proliferation, migration, adhesion, tube formation and survival of human lymphatic endothelial cells.
20029409 Observational study of gene-disease association. (HuGE Navigator)
19859801 Loss of NTN4 by methylation is associated with breast cancer.
19094984 A potential role for netrin-4 in regulating tumor growth.
18719102 Knockdown of Netrin-4 expression in EC increased their ability to form tubular structures; Netrin-4 bound only to neogenin but not to Unc5B or Unc5C receptors
17545519 NTN4, TRA1, and STC2 have roles in progression of breast cancer

AA Sequence

MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDL      1 - 70
TCRQPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPA     71 - 140
AMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAICTSKYSSPFPCTGGEVIFKALSPPYDTENP    141 - 210
YSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPV    211 - 280
KAPGTFHMVHGKCMCKHNTAGSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEA    281 - 350
SGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDC    351 - 420
PCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWE    421 - 490
WEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIF    491 - 560
RGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKLIVNMKSFVQHWKPSLGRKVMDILKRECK      561 - 628
//

Text Mined References (33)

PMID Year Title
26394601 2015 Family-based genome scan for age at onset of late-onset Alzheimer's disease in whole exome sequencing data.
26390805 2015 Inhibition of human placental endothelial cell proliferation and angiogenesis by netrin-4.
25909166 2015 Netrin-4 as a biomarker promotes cell proliferation and invasion in gastric cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25288737 2014 Netrin-4 regulates thalamocortical axon branching in an activity-dependent fashion.
24972566 2014 miR-20a contributes to endometriosis by regulating NTN4 expression.
24716747 2014 Cord blood netrin-1 and -4 concentrations in term pregnancies with normal, restricted and increased fetal growth.
24265816 2013 NETRIN-4 protects glioblastoma cells FROM temozolomide induced senescence.
24120501 2013 miR-196a targets netrin 4 and regulates cell proliferation and migration of cervical cancer cells.
23921680 2013 A genome-wide association study in Koreans identifies susceptibility loci for allergic nickel dermatitis.
23535733 2013 Genome-wide association studies identify four ER negative-specific breast cancer risk loci.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
22705235 2012 Identification and localization of netrin-4 and neogenin in human first trimester and term placenta.
22496621 2012 Netrin-4 promotes glioblastoma cell proliferation through integrin ?4 signaling.
21799154 2011 Netrin-4 activates endothelial integrin {alpha}6{beta}1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406174 2011 Netrin-4 delays colorectal cancer carcinomatosis by inhibiting tumor angiogenesis.
20730893 2011 Netrin-4 is upregulated in breast carcinoma effusions compared to corresponding solid tumors.
20407033 2010 Netrin-4 induces lymphangiogenesis in vivo.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
19859801 2010 Genomic screening for genes upregulated by demethylation revealed novel targets of epigenetic silencing in breast cancer.
19094984 2009 Netrin-4 regulates angiogenic responses and tumor cell growth.
18719102 2008 Netrin-4 inhibits angiogenesis via binding to neogenin and recruitment of Unc5B.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17545519 2007 Identification of NTN4, TRA1, and STC2 as prognostic markers in breast cancer in a screen for signal sequence encoding proteins.
17174565 2007 Characterization of the receptors for axon guidance factor netrin-4 and identification of the binding domains.
15519678 2004 Identification of a novel alternative splicing form of human netrin-4 and analyzing the expression patterns in adult rat brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11038171 2000 A novel member of the netrin family, beta-netrin, shares homology with the beta chain of laminin: identification, expression, and functional characterization.
8635876 1996 Isolation of genes differentially expressed in human primary myoblasts and embryonal rhabdomyosarcoma.