Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.79
PubTator Score 28.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma -1.700 0.006
cystic fibrosis -2.365 0.000
medulloblastoma, large-cell -2.700 0.000
non-small cell lung cancer -2.567 0.000
lung adenocarcinoma -1.500 0.000
acute myeloid leukemia -1.200 0.023
psoriasis -1.500 0.000
Endometriosis -1.055 0.030
Breast cancer -3.000 0.000
lung carcinoma -1.300 0.000
spina bifida -1.847 0.032
ovarian cancer -2.300 0.001
pituitary cancer -1.400 0.002

Gene RIF (20)

PMID Text
26394601 We found statistically significant association with AAO for three genes (WRN, NTN4 and LAMC3) with common associated variants.
26390805 inhibits placental microvascular endothelial cells proliferation, tube-like formation, migration and spheroid sprouting
25909166 Ntn4 promotes the proliferation and motility of gastric cancer cells which is mediated by its receptor Neo and through further activation of multi-oncogenic pathways
25288737 NTN4 acts as a positive regulator for TC axon branching through activity-dependent expression
24972566 Increased expression of miR-20a may play an important role in the pathogenesis of ovarian endometriosis by suppressing NTN4 expression.
24716747 Increased maternal netrin-4 levels in IUGR neonates may reflect in utero hypoxia, while the negative correlations between fetal netrin-1 and -4 levels may exert the dynamic balance between their angio- and anti-angiogenic properties.
24265816 NETRIN-4 protects glioblastoma cells FROM temozolomide induced senescence.
24120501 NTN4 expression was downregulated in cervical cancer tissues compared to normal controls, and in vivo mRNA level of NTN4 inversely correlated with miR-196a expression.
23921680 GWAS study found two new SNPs associated with nickel dermatitis; SNPs are located in the NTN4 and PELI1 genes
22705235 pattern of distribution suggests that a functional netrin-4-neogenin pathway might be restricted to syncytiotrophoblasts, mesenchymal cells, and villous endothelial cells
More...

AA Sequence

MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDL      1 - 70
TCRQPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPA     71 - 140
AMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAICTSKYSSPFPCTGGEVIFKALSPPYDTENP    141 - 210
YSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPV    211 - 280
KAPGTFHMVHGKCMCKHNTAGSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEA    281 - 350
SGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDC    351 - 420
PCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWE    421 - 490
WEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIF    491 - 560
RGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKLIVNMKSFVQHWKPSLGRKVMDILKRECK      561 - 628
//

Text Mined References (33)

PMID Year Title
26394601 2015 Family-based genome scan for age at onset of late-onset Alzheimer's disease in whole exome sequencing data.
26390805 2015 Inhibition of human placental endothelial cell proliferation and angiogenesis by netrin-4.
25909166 2015 Netrin-4 as a biomarker promotes cell proliferation and invasion in gastric cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25288737 2014 Netrin-4 regulates thalamocortical axon branching in an activity-dependent fashion.
24972566 2014 miR-20a contributes to endometriosis by regulating NTN4 expression.
24716747 2014 Cord blood netrin-1 and -4 concentrations in term pregnancies with normal, restricted and increased fetal growth.
24265816 2013 NETRIN-4 protects glioblastoma cells FROM temozolomide induced senescence.
24120501 2013 miR-196a targets netrin 4 and regulates cell proliferation and migration of cervical cancer cells.
23921680 2013 A genome-wide association study in Koreans identifies susceptibility loci for allergic nickel dermatitis.
More...