Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.75
PubTator Score 174.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 1.500 4.7e-02
Breast cancer -1.300 1.7e-06
Chronic Lymphocytic Leukemia -1.994 3.0e-06
dermatomyositis 1.400 9.3e-03
diabetes mellitus -1.200 8.3e-03
glioblastoma 1.200 2.3e-02
intraductal papillary-mucinous adenoma (... -1.400 5.5e-03
intraductal papillary-mucinous carcinoma... -1.200 4.1e-02
juvenile dermatomyositis 1.132 4.4e-08
lung cancer -1.100 2.2e-02
medulloblastoma, large-cell -1.400 1.5e-05
mucosa-associated lymphoid tissue lympho... 1.172 4.4e-02
Multiple myeloma 1.034 3.2e-02
ovarian cancer -1.400 2.8e-03
pancreatic cancer 1.200 1.6e-03
primary pancreatic ductal adenocarcinoma 1.355 2.8e-03
subependymal giant cell astrocytoma 2.534 8.0e-03
tuberculosis 1.100 2.8e-05
Waldenstrons macroglobulinemia -2.150 1.1e-05

Gene RIF (2)

AA Sequence

MELALRRSPVPRWLLLLPLLLGLNAGAVIDWPTEEGKEVWDYVTVRKDAYMFWWLYYATNSCKNFSELPL      1 - 70
VMWLQGGPGGSSTGFGNFEEIGPLDSDLKPRKTTWLQAASLLFVDNPVGTGFSYVNGSGAYAKDLAMVAS     71 - 140
DMMVLLKTFFSCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKCNFAGVALGDSWISPVDSVL    141 - 210
SWGPYLYSMSLLEDKGLAEVSKVAEQVLNAVNKGLYREATELWGKAEMIIEQNTDGVNFYNILTKSTPTS    211 - 280
TMESSLEFTQSHLVCLCQRHVRHLQRDALSQLMNGPIRKKLKIIPEDQSWGGQATNVFVNMEEDFMKPVI    281 - 350
SIVDELLEAGINVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWKALYSDPKSLETSAFVKSYKN    351 - 420
LAFYWILKAGHMVPSDQGDMALKMMRLVTQQE                                          421 - 452
//

Text Mined References (17)

PMID Year Title