Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.12
PubTator Score 0.81

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MGGSGVGTAWHGPLARPSGTLPFASSMPSPVDASSADGGSGLGSHRRKRTTFSKGQLLELERAFAAWPYP      1 - 70
NISTHEHLAWVTCLPEAKVQVWFQKRWAKIIKNRKSGILSPGSECPQSSCSLPDTLQQPWDPQMPGQPPP     71 - 140
SSGTPQRTSVCRHSSCPAPGLSPRQGWEGAKAVAPWGSAGASEVHPSLERATPQTSLGSLSDLIYALAIV    141 - 210
VNVDHS                                                                    211 - 216
//

Text Mined References (5)

PMID Year Title