Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.07
PubTator Score 0.81

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
22082156 Knockdown of SEBOX homeobox by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
10922053 This publication reported the human SEBOX gene sequence and predicted amino acid sequence, in addition to mouse and rat Sebox gene sequences.

AA Sequence

MGGSGVGTAWHGPLARPSGTLPFASSMPSPVDASSADGGSGLGSHRRKRTTFSKGQLLELERAFAAWPYP      1 - 70
NISTHEHLAWVTCLPEAKVQVWFQKRWAKIIKNRKSGILSPGSECPQSSCSLPDTLQQPWDPQMPGQPPP     71 - 140
SSGTPQRTSVCRHSSCPAPGLSPRQGWEGAKAVAPWGSAGASEVHPSLERATPQTSLGSLSDLIYALAIV    141 - 210
VNVDHS                                                                    211 - 216
//

Text Mined References (5)

PMID Year Title
25080503 2014 Meta-analysis of genome-wide association studies identifies two loci associated with circulating osteoprotegerin levels.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
10922053 2000 Mouse Sebox homeobox gene expression in skin, brain, oocytes, and two-cell embryos.