Property Summary

NCBI Gene PubMed Count 27
Grant Count 9
R01 Count 2
Funding $308,556.61
PubMed Score 27.86
PubTator Score 11.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.400 0.001
tuberculosis -1.300 0.000

Gene RIF (12)

PMID Text
26269592 The ubiquitin-binding Tollip protein contributed to IL-36R signaling and increased the accumulation of both subunits of the IL-36R.
25902739 IL36A-IL36R axis is modulated in patients with primary Sjogren's syndrome.
22315422 These data provide evidence that IL-38 binds to the IL-36R, as does IL-36Ra.[IL-38, IL-36R]
22144259 Expression of IL-1Rrp2 by sone dendritic cell subsets may have an important function in the human immune response in vivo via its role in differentiation of inflammatory Th1 lymphocytes.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20353565 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19684156 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19180518 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQ      1 - 70
SRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGK     71 - 140
DDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRLLVSNVSAEDRGNYACQAILTHSGKQYEVLN    141 - 210
GITVSITERAGYGGSVPKIIYPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRI    211 - 280
REGVETHVSFREHNLYTVNITFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAV    281 - 350
SVVYIYNIFKIDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPEVLERQCGYK    351 - 420
LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPESLGFGLLKNLSEEQIAVYSALIQDGMKVILIELEK    421 - 490
IEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMKTKFWKTVRYHMPPRRCRPFPPVQLLQHTPCYRTAG    491 - 560
PELGSRRKKCTLTTG                                                           561 - 575
//

Text Mined References (31)

PMID Year Title
26269592 2015 Signal Transduction and Intracellular Trafficking by the Interleukin 36 Receptor.
25902739 2015 Interleukin-36? axis is modulated in patients with primary Sjögren's syndrome.
24829417 2014 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin.
23999434 2013 Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling.
23966867 2013 Genome-wide association of body fat distribution in African ancestry populations suggests new loci.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22315422 2012 IL-38 binds to the IL-36 receptor and has biological effects on immune cells similar to IL-36 receptor antagonist.
22144259 2012 Expression of IL-1Rrp2 by human myelomonocytic cells is unique to DCs and facilitates DC maturation by IL-1F8 and IL-1F9.
21860022 2011 IL-36R ligands are potent regulators of dendritic and T cells.
More...