Property Summary

NCBI Gene PubMed Count 29
PubMed Score 13.97
PubTator Score 20.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 1.218 4.1e-06
adult high grade glioma -1.200 7.3e-03
astrocytic glioma -1.500 4.3e-03
atypical teratoid / rhabdoid tumor -1.800 1.9e-07
cutaneous lupus erythematosus -1.100 2.4e-03
ependymoma -1.400 1.1e-02
fascioscapulohumeral muscular dystrophy 1.192 2.7e-07
glioblastoma -1.300 2.2e-05
group 3 medulloblastoma -1.800 2.1e-03
intraductal papillary-mucinous adenoma (... 1.100 4.6e-03
intraductal papillary-mucinous carcinoma... 1.100 5.5e-03
lung adenocarcinoma -1.100 1.5e-17
medulloblastoma, large-cell -1.800 8.5e-04
oligodendroglioma -1.400 1.1e-02
osteosarcoma 3.499 6.1e-09
ovarian cancer -1.300 6.8e-06
pancreatic cancer -1.400 1.1e-03
pancreatic carcinoma -1.400 1.1e-03
Pick disease -1.300 6.1e-03
pituitary cancer -1.300 4.2e-03
psoriasis 1.300 5.4e-04
spina bifida -1.319 2.7e-02

Protein-protein Interaction (4)

Gene RIF (14)

AA Sequence

MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQNLPSGSSRVGAIKLTYISKVSDA      1 - 70
TKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVS     71 - 140
YRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQDSAVIKAGYCVKQGAVMKNWKR    141 - 210
RYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSW    211 - 280
IKAVSGAIVAQRGPGRSASSEHPPGPSESKHAFRPTNAATATSHSTASRSNSLVSTFTMEKRGFYESLAK    281 - 350
VKPGNFKVQTVSPREPASKVTEQALLRPQSKNGPQEKDCDLVDLDDASLPVSDV                    351 - 404
//

Text Mined References (33)

PMID Year Title